ADAM12 Protein, Mouse (Baculovirus, His-Myc)

ADAM12 Protein, Mouse (Baculovirus, His-Myc) is a disintegrin and a metalloprotease. ADAM12 is upregulated in epithelial cancers and contributes to increased tumor proliferation, metastasis, and endocrine resistance.

ADAM12 (a disintegrin and metalloprotease) is upregulated in breast, prostate, ovarian, skin, stomach, lung and brain cancers. Human ADAM12 can be expressed as two alternately spliced variants: the membrane-associated ADAM12-L, and the shorter secreted ADAM12-S. Both isoforms are composed of pro-, metalloprotease, disintegrin and cysteine-rich domains respectively, and a non-homologous cytoplasmic tail. ADAM12-L has a transmembrane region. ADAM12 contributes to tumor progression and metastasis in both orthotopic and transgenic tumor models by promoting tumor cell proliferation, migration and invasion, inducing tumor cell resistance to apoptosis, promoting endocrine resistance and enhancing malignant tumor-stroma crosstalk^[1][2].

Mouse

Sf9 insect cells

N-10*His;C-Myc

Q61824 (E206-G706)

11489  [NCBI]

ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG

Approximately 58.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Roopali Roy, ey al. ADAM12 Is a Novel Regulator of Tumor Angiogenesis via STAT3 Signaling. Mol Cancer Res. 2017 Nov;15(11):1608-1622.  [Content Brief]

  [2]. Saioa Mendaza, et al. ADAM12 is A Potential Therapeutic Target Regulated by Hypomethylation in Triple-Negative Breast Cancer. Int J Mol Sci. 2020 Jan 30;21(3):903.  [Content Brief]