Copy Link Print Information

ADAM12 Protein, Mouse (sf9, His-Myc)

Customer Review

Based on 1 Customer Validation

ADAM12 Protein, Mouse (sf9, His-Myc) is a disintegrin and a metalloprotease. ADAM12 is upregulated in epithelial cancers and contributes to increased tumor proliferation, metastasis, and endocrine resistance.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ADAM12 Protein, Mouse (sf9, His-Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ADAM12 Protein, Mouse (sf9, His-Myc) is a disintegrin and a metalloprotease. ADAM12 is upregulated in epithelial cancers and contributes to increased tumor proliferation, metastasis, and endocrine resistance.

Background

ADAM12 (a disintegrin and metalloprotease) is upregulated in breast, prostate, ovarian, skin, stomach, lung and brain cancers. Human ADAM12 can be expressed as two alternately spliced variants: the membrane-associated ADAM12-L, and the shorter secreted ADAM12-S. Both isoforms are composed of pro-, metalloprotease, disintegrin and cysteine-rich domains respectively, and a non-homologous cytoplasmic tail. ADAM12-L has a transmembrane region. ADAM12 contributes to tumor progression and metastasis in both orthotopic and transgenic tumor models by promoting tumor cell proliferation, migration and invasion, inducing tumor cell resistance to apoptosis, promoting endocrine resistance and enhancing malignant tumor-stroma crosstalk[1][2].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-10*His;C-Myc
  • Accession

    Q61824 (E206-G706)

  • Gene ID
    11489  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • ADAM12 (E206-G706)
      Accession # Q61824
    • Myc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ADAM12; Metalloprotease-Disintegrin 12 Transmembrane; ADAM Metallopeptidase Domain 12; Meltrin Alpha; MLTN; ADAM12-OT1; MCMPMltna; ADAM 12; Disintegrin And Metalloproteinase Domain-Containing Protein 12; CAR10; Meltrin-Alpha; MLTNA; A Disintegrin And Meta

  • AA Sequence

    ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG

  • Predicted Molecular Mass

    58.4 kDa

  • Molecular Weight

    Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

References

[1]. Roopali Roy, ey al. ADAM12 Is a Novel Regulator of Tumor Angiogenesis via STAT3 Signaling. Mol Cancer Res. 2017 Nov;15(11):1608-1622. [Content Brief]

[2]. Saioa Mendaza, et al. ADAM12 is A Potential Therapeutic Target Regulated by Hypomethylation in Triple-Negative Breast Cancer. Int J Mol Sci. 2020 Jan 30;21(3):903. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ADAM12 Protein, Mouse (sf9, His-Myc) Product Image
    1/16
  • ADAM12 Protein, Mouse (sf9, His-Myc) Product Image