AGR3 Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
AGR3 Protein, Human (HEK293, His) is human recombinant AG-3 with a N-terminal His tag. AG-3 Protein, Human (HEK293, His) is expressed in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AGR3 Protein, Human (HEK293, His) is human recombinant AG-3 with a N-terminal His tag. AG-3 Protein, Human (HEK293, His) is expressed in HEK293 cells.
Background
AGR3 (Anterior gradient 3; AG-3), a member of the protein disulfide isomerase (PDI) family, shares high sequence homology with AG-2. AGR3 is overexpressed in breast, prostate and ovarian cancer. Combined AGR3 and acid mucopolysaccharides could serve as a diagnostic marker for well-differentiated intrahepatic cholangiocarcinoma. AGR3 expression was correlated with the level of differentiation in the serous type of ovarian cancer. AGR3 activates Wnt/β-catenin signalling and promotes the nuclear translocation of β-catenin to upregulate stemness related genes[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
SLAS Discov
Development of a rapid and sensitive EnLIGHT OMEGA assay for extracellular AGR2 detection in biological fluids. [Abstract]2026 Jun 10:42:100315. PMID: 42269775
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8TD06 (I22-L166)
-
Molecular Construction
-
N-term
-
AGR3 (I22-L166)
Accession # Q8TD06 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AGR3; Anterior Gradient Protein 3; Anterior Gradient 3, Protein Disulphide Isomerase Family Member; AG-3; BCMP11; AG3; PDIA18; Anterior Gradient 3 Homolog (Xenopus Laevis); HAG-3; Anterior Gradient Protein 3 Homolog; Protein Disulfide Isomerase Family A,
-
AA Sequence
IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
-
Predicted Molecular Mass
18 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM EDTA, pH 8.5 or 20 mM Glycine-HCl, 10% Trehalose, 0.05% Tween80, pH 3.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
