AGPAT4 Protein, Human (Cell-Free, His)

The AGPAT4 protein plays a role in lipid metabolism by converting 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) play a vital role. An acyl moiety is incorporated (by similarity) at the sn-2 position of the glycerol backbone. AGPAT4 Protein, Human (Cell-Free, His) is the recombinant human-derived AGPAT4 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of AGPAT4 Protein, Human (Cell-Free, His) is 319 a.a., with molecular weight of 45.5 kDa.

The AGPAT4 protein plays a crucial role in lipid metabolism by converting 1-acyl-sn-glycerol-3-phosphate, also known as lysophosphatidic acid (LPA), into 1,2-diacyl-sn-glycerol-3-phosphate, commonly referred to as phosphatidic acid (PA). This enzymatic activity involves incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Notably, AGPAT4 exhibits a high acyl-CoA specificity, particularly for polyunsaturated fatty acyl-CoA, with a notable preference for docosahexaenoyl-CoA (22:6-CoA, DHA-CoA). This specificity highlights the enzyme's role in the biosynthesis of specific phospholipids and underscores its significance in the regulation of cellular lipid composition, especially with regard to polyunsaturated fatty acids (

Human

E. coli Cell-free

N-10*His

Q9NRZ5 (M1-D319)

56895

MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND

45.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.