Aminopeptidase P1 Protein, Human (His-SUMO)
Aminopeptidase P1 Protein, a metalloaminopeptidase, crucially catalyzes the removal of penultimate prolyl residues from peptide N-termini, including substrates like Arg-Pro-Pro. This activity significantly contributes to specific peptide degradation, exemplified in bradykinin processing. Aminopeptidase P1's selective prolyl cleavage underscores its importance in modulating peptide structures and functions within biological systems. Aminopeptidase P1 Protein, Human (His-SUMO) is the recombinant human-derived Aminopeptidase P1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Aminopeptidase P1 Protein, a metalloaminopeptidase, crucially catalyzes the removal of penultimate prolyl residues from peptide N-termini, including substrates like Arg-Pro-Pro. This activity significantly contributes to specific peptide degradation, exemplified in bradykinin processing. Aminopeptidase P1's selective prolyl cleavage underscores its importance in modulating peptide structures and functions within biological systems. Aminopeptidase P1 Protein, Human (His-SUMO) is the recombinant human-derived Aminopeptidase P1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
Aminopeptidase P1 Protein, a metalloaminopeptidase, plays a crucial role in peptide metabolism by catalyzing the removal of penultimate prolyl residues from the N-termini of peptides, including substrates such as Arg-Pro-Pro. This enzymatic activity contributes significantly to the degradation of specific peptides, exemplified by its role in the processing of bradykinin. The selective cleavage of prolyl residues by Aminopeptidase P1 underscores its importance in modulating peptide structures and functions within biological systems.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q9NQW7-1 (P2-H623)
-
Protein Length
Full Length of Isoform-1
-
Synonyms
XPNPEP1; X-Prolyl Aminopeptidase 1; XPNPEPL1; XPNPEPL; XPNPEP; Xaa-Pro Aminopeptidase 1; X-Prolyl Aminopeptidase (Aminopeptidase P) 1; Soluble; X-Prolyl Aminopeptidase 1; Soluble; Aminoacylproline Aminopeptidase; Cytosolic Aminopeptidase P; Soluble Aminopeptidase P; X-Pro Aminopeptidase 1; X-Prolyl Aminopeptidase (Aminopeptidase P)-Like; Aminopeptidase P; Cytosolic; APP1; SAMP; SAmp
-
AA Sequence
PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
-
Predicted Molecular Mass
85.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
