Copy Link Print Information

Aminopeptidase P1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Aminopeptidase P1 Protein, Human (His)
  • Aminopeptidase P1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline[1].

Background

Aminopeptidase P1 (APP1) has been identified in human leukocytes, human platelets, rat brain, and guinea pig serum. This enzyme exhibits broad substrate specificity for peptides of diverse sizes. Deficiency in APP activity has been known to cause human peptiduria, which is the massive urinary excretion of undigested imino-oligopeptide[1].

Verified Bioactivity

Measured by its ability to cleave 50 μM fluorogenic peptide substrate, H-Lys (2-Aminobenzoyl)-Pro-Pro-p-Nitroanilide (K(Abz)PP-pNA) that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 3085.35 pmol/min/µg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 85%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q9NQW7-1 (P2-Q622)

  • Gene ID
    7511  [NCBI]
  • Molecular Construction
    • N-term
    • XPNPEP1 (P2-Q622)
      Accession # Q9NQW7-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    XPNPEP1; X-Prolyl Aminopeptidase 1; XPNPEPL1; XPNPEPL; XPNPEP; Xaa-Pro Aminopeptidase 1; X-Prolyl Aminopeptidase (Aminopeptidase P) 1; Soluble; X-Prolyl Aminopeptidase 1; Soluble; Aminoacylproline Aminopeptidase; Cytosolic Aminopeptidase P; Soluble Aminopeptidase P; X-Pro Aminopeptidase 1; X-Prolyl Aminopeptidase (Aminopeptidase P)-Like; Aminopeptidase P; Cytosolic; APP1; SAMP; SAmp

  • AA Sequence

    PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQ

  • Predicted Molecular Mass

    70.6 kDa

  • Molecular Weight

    Approximately 69-85 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% glycerol, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM PB, 8% sucrose, 100 mM NaCl, 10% glycerol, 0.05% Tween 80, 0.02% Tween 20, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Yoon SH, et al. Developmental retardation, microcephaly, and peptiduria in mice without aminopeptidase P1. Biochem Biophys Res Commun. 2012 Dec 14;429(3-4):204-9. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 85%, as determined by reducing SDS-PAGE.

  • Aminopeptidase P1 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Aminopeptidase P1 Protein, Human (His)
  • Aminopeptidase P1 Protein, Human (His) Product Image