1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Aminopeptidase P1 Protein, Human (His)

Aminopeptidase P1 Protein, Human (His)

Cat. No.: HY-P7498
COA Handling Instructions

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $210 In-stock
50 μg $590 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline[1].

Background

Aminopeptidase P1 (APP1) has been identified in human leukocytes, human platelets, rat brain, and guinea pig serum. This enzyme exhibits broad substrate specificity for peptides of diverse sizes. Deficiency in APP activity has been known to cause human peptiduria, which is the massive urinary excretion of undigested imino-oligopeptide[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9NQW7 (P2-Q622)

Gene ID
Molecular Construction
N-term
XPNPEP1 (P2-Q622)
Accession # Q9NQW7
6*His
C-term
Synonyms
rHuAminopeptidase P1, His; XPNPEP1; Aminopeptidase P1
AA Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQ

Molecular Weight

Approximately 77.0 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Aminopeptidase P1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aminopeptidase P1 Protein, Human (His)
Cat. No.:
HY-P7498
Quantity:
MCE Japan Authorized Agent: