Aminopeptidase P1 Protein, Human (His)

Aminopeptidase P1 Protein, Human (His) is a recombinant human Aminopeptidase P1 with a His tag at the C-terminus. Aminopeptidase P1 belongs to a family of aminopeptidase Ps (aminopeptidases P1-3 encoded by the Xpnpep1-3 genes) that cleave the N-terminal amino acid residue of peptides in which the penultimate amino acid is proline^[1].

Aminopeptidase P1 (APP1) has been identified in human leukocytes, human platelets, rat brain, and guinea pig serum. This enzyme exhibits broad substrate specificity for peptides of diverse sizes. Deficiency in APP activity has been known to cause human peptiduria, which is the massive urinary excretion of undigested imino-oligopeptide^[1].

Measured by its ability to cleave 50 μM fluorogenic peptide substrate, H-Lys (2-Aminobenzoyl)-Pro-Pro-p-Nitroanilide (K(Abz)PP-pNA) that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 3085.35 pmol/min/µg.

Human

E. coli

C-6*His

Q9NQW7 (P2-Q622)

7511  [NCBI]

Partial

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQ

Approximately 69-85 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 85%, as determined by reducing SDS-PAGE.

Solution.

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% glycerol, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM PB, 8% sucrose, 100 mM NaCl, 10% glycerol, 0.05% Tween 80, 0.02% Tween 20, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Yoon SH, et al. Developmental retardation, microcephaly, and peptiduria in mice without aminopeptidase P1. Biochem Biophys Res Commun. 2012 Dec 14;429(3-4):204-9.  [Content Brief]