Copy Link Print Information

Androgen receptor Protein, Human (His-SUMO, Myc)

Customer Review

Based on 1 Customer Validation

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Androgen receptor Protein, Human (His-SUMO, Myc)
  • Experimental Validation Results for Androgen receptor Protein, Human (His-SUMO, Myc)
  • Androgen receptor Protein, Human (His-SUMO, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Background

The androgen receptor, a steroid hormone receptor, functions as a ligand-activated transcription factor, regulating gene expression in eukaryotic cells and influencing cellular proliferation and differentiation. Its transcriptional activity is finely tuned by coactivator and corepressor proteins, such as ZBTB7A, which recruits NCOR1 and NCOR2 to androgen response elements (ARE) on target genes, thereby exerting a negative regulation on androgen receptor signaling and androgen-induced cell proliferation. Additionally, transcription activation is suppressed by NR0B2. HIPK3 and ZIPK/DAPK3 can activate the androgen receptor when activated but not phosphorylated. Interestingly, lacking the C-terminal ligand-binding domain, the androgen receptor may exhibit constitutive transcriptional activation of a specific gene set independently of steroid hormones, adding complexity to its regulatory functions.

Verified Bioactivity

Measured by its ability to inhibit migration of PC-3 cells. The ED50 for this effect is ≤ 1 μg/mL, corresponding to a specific activity is ≥1000 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit migration of PC-3 cells. The ED50 for this effect is 0.09167 μg/mL, corresponding to a specific activity is 1.091×10^4 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His;N-SUMO;C-Myc
  • Accession

    P10275-1 (D551-T919)

  • Gene ID
    367  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • AR (D551-T919)
      Accession # P10275-1
    • Myc
    • C-term
  • Protein Length

    Full Length of Interaction with LPXN Region

  • Synonyms

    AR; Spinal And Bulbar Muscular Atrophy; Prev. DHTR; Androgen Receptor Splice Variant 6; Prev. SBMA; Androgen Receptor Variant 5,6,7es; Dihydrotestosterone Receptor; Testicular Feminization; NR3C4; Kennedy Disease; Nuclear Receptor Subfamily 3 Group C Memb

  • AA Sequence

    DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

  • Predicted Molecular Mass

    56.1 kDa

  • Molecular Weight

    Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.1% SKL, 5 mM DTT.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit migration of PC-3 cells. The ED50 for this effect is 0.09167 μg/mL, corresponding to a specific activity is 1.091×10^4 U/mg.

  • Androgen receptor Protein, Human (His-SUMO, Myc) Product Image
    1/16
  • Experimental Validation Results for Androgen receptor Protein, Human (His-SUMO, Myc)
  • Experimental Validation Results for Androgen receptor Protein, Human (His-SUMO, Myc)
  • Androgen receptor Protein, Human (His-SUMO, Myc) Product Image