Androgen receptor Protein, Human (His-SUMO)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag. The total length of Androgen receptor Protein, Human (His-SUMO) is 369 a.a., with molecular weight of ~62.4 kDa.

The androgen receptor, a steroid hormone receptor, functions as a ligand-activated transcription factor, regulating gene expression in eukaryotic cells and influencing cellular proliferation and differentiation. Its transcriptional activity is finely tuned by coactivator and corepressor proteins, such as ZBTB7A, which recruits NCOR1 and NCOR2 to androgen response elements (ARE) on target genes, thereby exerting a negative regulation on androgen receptor signaling and androgen-induced cell proliferation. Additionally, transcription activation is suppressed by NR0B2. HIPK3 and ZIPK/DAPK3 can activate the androgen receptor when activated but not phosphorylated. Interestingly, lacking the C-terminal ligand-binding domain, the androgen receptor may exhibit constitutive transcriptional activation of a specific gene set independently of steroid hormones, adding complexity to its regulatory functions.

Human

E. coli

N-10*His;N-SUMO;C-Myc

P10275 (D551-T919)

367  [NCBI]

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Approximately 62.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.