1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANGPTLs
  5. ANGPTL8/Angiopoietin-related 4 Protein, Human (HEK293, Fc)

ANGPTL8/Angiopoietin-related 4 Protein, Human (HEK293, Fc)

Cat. No.: HY-P7506
Handling Instructions

ANGPTL 8 Protein, Human (HEK293, Fc) is a secreted inhibitor of LPL. Angiopoietin-like Protein 8 may function as an important metabolic switch, by forming complexes with ANGPTL3, or with ANGPTL4, in order to direct the flow of energy from triglycerides in blood according to the needs of the body.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

ANGPTL8/Angiopoietin-related 4 Protein, Human (HEK293, Fc) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

Q6UXH0 (A22-A198)

Gene ID

55908

Synonyms
rHuAngiopoietin-like Protein 8, N-Fc; ANGPTL8; Betatrophin; C19orf81; Angiopoietin-like Protein 8
AA Sequence

APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Molecular Weight

Approximately 54.0 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. ANGPTL4 and ANGPTL8 form a complex when refolded together and that ANGPTL4 in that complex loses its ability to inactivate LPL. We have observed that the C-terminal helix of ANGPTL8 is important for complex formation with ANGPTL3 or ANGPTL4, rather than for covering the functional site of the protein, as was previously proposed.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL8/Angiopoietin-related 4 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7506
Quantity:
MCE Japan Authorized Agent: