ANGPTL8/Angiopoietin-like 8 Protein, Human (HEK293, Fc)

ANGPTL 8 Protein, Human (HEK293, Fc) is a secreted inhibitor of LPL. Angiopoietin-like Protein 8 may function as an important metabolic switch, by forming complexes with ANGPTL3, or with ANGPTL4, in order to direct the flow of energy from triglycerides in blood according to the needs of the body.

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. ANGPTL4 and ANGPTL8 form a complex when refolded together and that ANGPTL4 in that complex loses its ability to inactivate LPL. We have observed that the C-terminal helix of ANGPTL8 is important for complex formation with ANGPTL3 or ANGPTL4, rather than for covering the functional site of the protein, as was previously proposed.

Measured by its binding ability in a functional ELISA. Immobilized ANGPTL3 (HY-P7505) at 1 μg/mL (100 μL/well) can bind ANGPTL8. The ED₅₀ for this effect is 0.5-1.5 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized ANGPTL3 (HY-P7505) at 1 μg/mL (100 μL/well) can bind ANGPTL8. The ED₅₀ for this effect is 1.108 μg/mL.

Human

HEK293

N-hFc

Q6UXH0 (A22-A198)

55908  [NCBI]

Full Length of Mature Protein

APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% Trehalose, 0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kovrov O, et al. On the mechanism of angiopoietin-like protein 8 for control of lipoprotein lipase activity. J Lipid Res. 2019 Apr;60(4):783-793.  [Content Brief]