2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Angiopoietins
  5. Angiopoietin Like 4
  6. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)

ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)

Cat. No.: HY-P700562
Handling Instructions

ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli, with N-GST labeled tag. The total length of ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is 376 a.a., with molecular weight of 69.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli, with N-GST labeled tag. The total length of ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is 376 a.a., with molecular weight of 69.6 kDa.
Background

The ANGPTL4/Angiopoietin-related 4 protein functions as a mediator in the inactivation of lipoprotein lipase (LPL), playing a crucial role in the regulation of triglyceride clearance from the blood serum and lipid metabolism. Additionally, it is implicated in the potential regulation of glucose homeostasis and insulin sensitivity. ANGPTL4 inhibits endothelial cell proliferation, migration, and tubule formation, thereby reducing vascular leakage. It also interferes with the adhesion of endothelial cells to the extracellular matrix, inhibiting the reorganization of the actin cytoskeleton, formation of actin stress fibers, and focal adhesions. In certain contexts, ANGPTL4 may modulate angiogenesis related to tumor development. The cleaved form of ANGPTL4 exhibits higher activity in LPL inactivation compared to the uncleaved protein, highlighting its multifaceted role in metabolic and vascular regulation.
Species

Human
Source

E. coli
Tag

N-GST
Accession

Q9BY76 (V28-E403)
Gene ID
Molecular Construction
N-term
GST
ANGPTL4 (V28-E403)
Accession # Q9BY76
C-term
Synonyms
Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein ; HFARP
AA Sequence

VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

Molecular Weight

69.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL4/Angiopoietin-related 4 Protein, Human (GST)
Cat. No.:
HY-P700562
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.