Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His)

4-1BBL/TNFSF9 Protein, a cytokine, binds TNFRSF9, inducing proliferation in activated peripheral blood T-cells. It's implicated in activation-induced cell death (AICD) and contributes to cognate interactions between T-cells and B-cells/macrophages. Functioning as a homotrimer enhances its biological activity. Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) is the recombinant mouse-derived animal-Free4-1BBL/TNFSF9 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free 4-1BBL/TNFSF9 Protein, Mouse (His) is 108 a.a., with molecular weight of ~23.91 kDa.

The 4-1BBL/TNFSF9 protein is a cytokine that specifically binds to TNFRSF9, triggering the proliferation of activated peripheral blood T-cells. It is believed to be involved in activation-induced cell death (AICD) and may also contribute to the cognate interactions between T-cells and B-cells/macrophages. This protein functions as a homotrimer, further enhancing its biological activity.

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <0.05 μg/mL.

Mouse

E. coli

C-His

P41274 (R104-T211)

21950  [NCBI]

MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFT

Approximately 23.91 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.