Animal-Free DCIP-1/CXCL3 Protein, Mouse (His)

DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is 73 a.a., with molecular weight of ~8.72 kDa.

The DCIP-1/CXCL3 protein functions as a ligand for CXCR2, displaying chemotactic activity for neutrophils. This protein is implicated in inflammation and may exert its effects on endothelial cells in an autocrine fashion. The chemotactic activity of DCIP-1/CXCL3 for neutrophils suggests its potential role in regulating the recruitment and activation of these immune cells in response to inflammatory stimuli.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <80 ng/mL

Mouse

E. coli

N-His

Q6W5C0 (A28-S100)

330122  [NCBI]

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Approximately 8.72 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.