Animal-Free DCIP-1/CXCL3 Protein, Mouse (His)
Based on 1 Customer Validation
DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DCIP-1/CXCL3 Protein, a CXCR2 ligand, exhibits chemotactic activity for neutrophils, implicating its role in inflammation. It may autonomously affect endothelial cells. The protein's chemotactic activity implies a potential regulatory role in recruiting and activating neutrophils in response to inflammatory stimuli. Animal-Free DCIP-1/CXCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeDCIP-1/CXCL3 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background
The DCIP-1/CXCL3 protein functions as a ligand for CXCR2, displaying chemotactic activity for neutrophils. This protein is implicated in inflammation and may exert its effects on endothelial cells in an autocrine fashion. The chemotactic activity of DCIP-1/CXCL3 for neutrophils suggests its potential role in regulating the recruitment and activation of these immune cells in response to inflammatory stimuli.
Verified Bioactivity
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <80 ng/mL
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q6W5C0 (A28-S100)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL3 (A28-S100)
Accession # Q6W5C0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL3; C-X-C Motif Chemokine 3; Prev. GRO3; GRO3 Oncogene; SCYB3; GRO-Gamma; CINC-2b; MIP2-Beta; MIP-2b; Melanoma Growth Stimulatory Activity Gamma; GROg; MGSA Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2B; Chemokine (C-X-C Motif) Ligand 3; GROG; G
-
AA Sequence
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
-
Predicted Molecular Mass
8.7 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
