Animal-Free IL-27 beta/EBI3 Protein, Human (His)

The IL-27 beta/EBI3 Protein, in conjunction with IL27, forms the IL-27 interleukin, pivotal in innate immunity. Possessing dual pro- and anti-inflammatory properties, IL-27 regulates T-helper cell development, inhibits T-cell proliferation, stimulates cytotoxic T-cell activity, induces B-cell isotype switching, and impacts innate immune cells. Under IL-27 influence, CD4 T-helper cells differentiate into TH1, TH2, and TH17 cells. IL-27 promotes rapid clonal expansion of naive CD4 T-cells, synergizes with IL-12 for IFN-gamma production, and contributes to antitumor and antiangiogenic activities through WSX-1/TCCR receptor activation. It forms heterodimers with IL27/IL27A (IL-27) and IL12A (IL-35), with no disulfide linkage, and interacts with SQSTM1. Animal-Free IL-27 beta/EBI3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-27 beta/EBI3 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-27 beta/EBI3 Protein, Human (His) is 209 a.a., with molecular weight of ~24.25 kDa.

The IL-27 beta/EBI3 Protein associates with IL27 to constitute the IL-27 interleukin, a heterodimeric cytokine that plays a crucial role in innate immunity. Demonstrating both pro- and anti-inflammatory properties, IL-27 regulates T-helper cell development, inhibits T-cell proliferation, stimulates cytotoxic T-cell activity, induces isotype switching in B-cells, and exerts diverse effects on innate immune cells. CD4 T-helper cells, under IL-27 influence, can differentiate into type 1 effector cells (TH1), type 2 effector cells (TH2), and IL-17-producing helper T-cells (TH17). IL-27 facilitates the rapid clonal expansion of naive CD4 T-cells, but not memory CD4 T-cells, and synergizes strongly with IL-12 to induce interferon-gamma/IFN-gamma production by naive CD4 T-cells. Binding to the cytokine receptor WSX-1/TCCR, IL-27 contributes to the antitumor and antiangiogenic activities, leading to the activation of production of antiangiogenic chemokines. It forms heterodimers with IL27/IL27A, recognized as interleukin IL-27, and with IL12A, forming interleukin IL-35, both not disulfide-linked. Additionally, IL-27 interacts with SQSTM1.

Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <2 ng/mL.

Human

E. coli

C-His

Q14213 (R21-K229)

10148  [NCBI]

MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Approximately 24.25 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.