Animal-Free NAP-2/CXCL7 Protein, Mouse (62a.a, His)

NAP-2/CXCL7 proteins are members of the intercrine alpha family and are associated with chemokines that regulate intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 may regulate inflammatory processes and cellular interactions. Animal-Free NAP-2/CXCL7 Protein, Mouse (62a.a, His) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

The NAP-2/CXCL7 protein is a member of the intercrine alpha (chemokine CxC) family. This classification highlights its affiliation with a group of chemokines involved in intercellular communication and immune responses. As part of the intercrine alpha family, NAP-2/CXCL7 likely plays a role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to uncover the specific functions and implications of this protein within the broader context of the chemokine CxC family, shedding light on its significance in mediating immune responses without reliance on animal-derived sources.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <5 ng/mL.

Mouse

E. coli

N-6*His

Q9EQI5 (I48-Y113)

57349  [NCBI]

Partial

IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.