1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CTAP-III/CXCL7
  6. Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a)

Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a)

Cat. No.: HY-P700175AF
COA Handling Instructions

NAP-2/CXCL7 proteins are members of the intercrine alpha family and are associated with chemokines that regulate intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 may regulate inflammatory processes and cellular interactions. Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a) is 66 a.a., with molecular weight of ~7.57 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $71 In-stock
10 μg $200 In-stock
50 μg $560 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NAP-2/CXCL7 proteins are members of the intercrine alpha family and are associated with chemokines that regulate intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 may regulate inflammatory processes and cellular interactions. Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a) is 66 a.a., with molecular weight of ~7.57 kDa.

Background

The NAP-2/CXCL7 protein is a member of the intercrine alpha (chemokine CxC) family. This classification highlights its affiliation with a group of chemokines involved in intercellular communication and immune responses. As part of the intercrine alpha family, NAP-2/CXCL7 likely plays a role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to uncover the specific functions and implications of this protein within the broader context of the chemokine CxC family, shedding light on its significance in mediating immune responses without reliance on animal-derived sources.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q9EQI5 (I48-Y113)

Gene ID

57349  [NCBI]

Molecular Construction
N-term
His
CXCL7 (I48-Y113)
Accession # Q9EQI5
C-term
Synonyms
C-X-C motif chemokine 7; PBP; LDGF; MDGF; CTAP-III; PPBP; NAP-2; CXCL7
AA Sequence

IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI

Molecular Weight

Approximately 7.57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free NAP-2/CXCL7 Protein, Mouse (His, 62 a.a)
Cat. No.:
HY-P700175AF
Quantity:
MCE Japan Authorized Agent: