Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His)

Apoptosis inhibitor 4/Birc5 has the dual effects of promoting cell proliferation and inhibiting apoptosis. As an important component of the chromosomal channel protein complex (CPC), Birc5 coordinates chromosome alignment and segregation during mitosis and cytokinesis. Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Apoptosis inhibitor 4/Birc5 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Apoptosis inhibitor 4/Birc5 has the dual effects of promoting cell proliferation and inhibiting apoptosis. As an important component of the chromosomal channel protein complex (CPC), Birc5 coordinates chromosome alignment and segregation during mitosis and cytokinesis. Apoptosis inhibitor 4/Birc5 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Apoptosis inhibitor 4/Birc5 protein, expressed by P. pastoris , with N-His labeled tag.

Background

Apoptosis inhibitor 4/Birc5, a versatile protein, assumes dual roles in promoting cell proliferation and thwarting apoptosis. As a crucial component of the chromosome passage protein complex (CPC), Birc5 plays an essential role in orchestrating chromosome alignment and segregation throughout mitosis and cytokinesis. It directs CPC movement, ensuring its localization shifts from the inner centromere in prometaphase to the midbody during cytokinesis, contributing to the organization of the central spindle by associating with polymerized microtubules. Birc5 is instrumental in recruiting CPC to centromeres during early mitosis, binding to histone H3 phosphorylated at 'Thr-3' (H3pT3). Functioning in concert with RAN, Birc5 aids in mitotic spindle formation, acting as a scaffold for the delivery of the RAN effector molecule TPX2 to microtubules. Additionally, it counteracts default induction of apoptosis in G2/M phase and, when acetylated, represses STAT3 transactivation of target gene promoters. Birc5 serves as an inhibitor of CASP3 and CASP7, crucial for the maintenance of mitochondrial integrity and function. Existing as a monomer in the CPC-bound state, Birc5 protects cells against apoptosis more efficiently than in its homodimeric form. It engages in a complex network of interactions with various proteins, such as histone H3, RAN, tubulin, XIAP/BIRC4, and DIABLO/SMAC, highlighting its multifaceted regulatory functions in cellular processes.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Birc5 (M1-A140)
      Accession # O70201
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    BIRC5; Apoptosis Inhibitor 4; Prev. API4; Survivin; Baculoviral IAP Repeat-Containing Protein 5; Baculoviral IAP Repeat-Containing 5; Apoptosis Inhibitor Survivin; IAP4; Baculoviral IAP Repeat Containing 5; EPR-1

  • AA Sequence

    MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA

  • Predicted Molecular Mass

    18.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00