ARRB1/Beta-Arrestin 1 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation[1].
Background
β-arrestins binds to phosphorylated receptors, uncouple G proteins and link receptors to clathrin-dependent internalization pathways. β-arrestins may be crucial not only for limiting E2 signaling via membrane estrogen receptor-α (mERα) internalization, but may be involved in the initial estradiol (E2) membrane-initiated signaling (EMS) through an ERK1/2 pathway[1].
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Pharmacol Res
A broad-spectrum anti-angiogenic tetrapeptide regresses diabetic retinopathy through β-arrestin-1 binding and prevention of Akt phosphorylation. [Abstract]2025 Dec:222:108042. PMID: 41274394
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P49407 (M1-R418)
-
Molecular Construction
-
N-term
-
ARRB1 (M1-R418)
Accession # P49407 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
ARRB1; Arrestin Beta-1; Prev. ARR1; Arrestin, Beta 1; Beta-Arrestin-1; ARB1; Non-Visual Arrestin-2; Arrestin Beta 1; Arrestin 2
-
AA Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
-
Predicted Molecular Mass
48.1 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
