Azoreductase/NQO1 Protein, Mouse (P.pastoris, His)

The azoreductase/NQO1 protein reduces quinones to hydroquinone using NADH or NADPH as an electron donor. Azoreductase/NQO1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Azoreductase/NQO1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Azoreductase/NQO1 Protein, Mouse (P.pastoris, His) is 273 a.a., with molecular weight of ~33 kDa.

Azoreductase/NQO1 protein, a flavin-containing quinone reductase, plays a pivotal role in cellular redox regulation by catalyzing the two-electron reduction of quinones to hydroquinones, utilizing either NADH or NADPH as electron donors. Operating through a ping-pong kinetic mechanism, the enzyme sequentially transfers electrons from NAD(P)H to its flavin cofactor and then from the reduced flavin to the quinone, thereby bypassing the formation of semiquinone and reactive oxygen species. This process serves as a key component in quinone detoxification, regulating the cellular redox state. Azoreductase/NQO1 also contributes to the reduction of plasma membrane redox system components, such as coenzyme Q and vitamin quinones, generating antioxidant hydroquinone forms and potentially acting as a superoxide scavenger. Moreover, the protein exhibits versatility in its actions, as it can alternatively activate quinones and their derivatives, producing redox-reactive hydroquinones with DNA cross-linking antitumor potential. Furthermore, Azoreductase/NQO1 functions as a gatekeeper of the core 20S proteasome, interacting with tumor suppressors TP53 and TP73 in a NADH-dependent manner to inhibit their ubiquitin-independent degradation during oxidative stress.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

P. pastoris

N-6*His

Q64669 (A2-K274)

18104  [NCBI]

AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Approximately 33 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCI, 0.5 M NaCI, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.