B5R Protein, Vaccinia virus (Cell-Free, His)

B5R proteins are members of the complement-activating receptor (RCA) family and lack conserved residues critical for feature annotation propagation, suggesting that this family has unique structural or functional properties. Studying B5R helps to understand its specific functions and interactions in complement activation, emphasizing its uniqueness. B5R Protein, Vaccinia virus (Cell-Free, His) is the recombinant Virus-derived B5R protein, expressed by E. coli Cell-free , with N-6*His labeled tag. The total length of B5R Protein, Vaccinia virus (Cell-Free, His) is 317 a.a., with molecular weight of 41.1 kDa.

The B5R Protein is a member of the receptors of complement activation (RCA) family, a classification that indicates its involvement in complement activation processes. However, it is noteworthy that B5R lacks conserved residue(s) required for the propagation of feature annotation. This suggests unique structural characteristics or functional properties within the RCA family, emphasizing the distinctiveness of B5R in comparison to other family members. The study of B5R contributes to our understanding of its specific functions and interactions within the context of complement activation, shedding light on potential variations in its regulatory mechanisms. Further exploration of B5R's role, especially regarding the absence of conserved residues, holds promise for enhancing our knowledge of its contributions to immune responses and related physiological processes.

Virus

E. coli Cell-free

N-6*His

Q80KX4 (M1-P317)

/

MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

41.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.