2. Recombinant Proteins
  3. Cytokines and Growth Factors CD Antigens
  4. TNF Superfamily Macrophage CD Proteins
  5. TNF Receptor Superfamily BAFF R/CD268
  6. BAFF Receptor
  7. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag)

BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag)

Cat. No.: HY-P700453
Handling Instructions

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc, C-Flag labeled tag. The total length of BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) is 65 a.a., with molecular weight of 36.4 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-hFc, C-Flag labeled tag. The total length of BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) is 65 a.a., with molecular weight of 36.4 kDa.
Background

BAFFR/TNFRSF13C protein is a B-cell receptor that specifically recognizes TNFSF13B/TALL1/BAFF/BLyS. It plays a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to the maintenance of a healthy immune system.
Species

Human
Source

HEK293
Tag

C-hFc;C-Flag
Accession

Q96RJ3 (S7-A71)
Gene ID
Molecular Construction
N-term
BAFFR (S7-A71)
Accession # Q96RJ3
hFc-Flag
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 13C; BAFF-R; CD268; TNFRSF13C; BR3
AA Sequence

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Molecular Weight

36.4 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag)
Cat. No.:
HY-P700453
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.