BCL2 Protein, Human (His)

BCL2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Proteins of the Bcl-2 family are important regulators of apoptosis in many tissues of the embryo and adult^[1].

Key regulators include proteins of the Bcl-2 family, some of which (e.g., Bcl-2, Bcl-xL, Mcl-1, and A1) promote cell survival while others (e.g., Bax and Bak) antagonize it. Disrupted regulation of apoptosis is implicated strongly in cancer and in autoimmune and degenerative diseases^[1].

Measured by its binding ability in a functional ELISA. When Recombinant Human BCL2 is present at 10 μg/mL, can bind Recombinant Mouse Bcl-XL. The ED₅₀ for this effect is 0.1441 μg/mL.

Human

E. coli

C-6*His

P10415-1 (M1-D211)

596  [NCBI]

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

Approximately 22-27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filter solution of 50 mM Tris-HCl, 10% glycerin, pH 8.0 or 50 mM Tris-HCL, 150 mM NaCl, 100mM arginine, pH 8.0 , 20% Glycerol.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Print CG, et al. Apoptosis regulator bcl-w is essential for spermatogenesis but appears otherwise redundant. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12424-31.  [Content Brief]