1. Recombinant Proteins
  2. Others
  3. BCL2 Protein, Human (His)

BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

BCL2 Protein, Human (His) Featured Recommendations:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE BCL2 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.

Background

Key regulators include proteins of the Bcl-2 family, some of which (e.g., Bcl-2, Bcl-xL, Mcl-1, and A1) promote cell survival while others (e.g., Bax and Bak) antagonize it. Disrupted regulation of apoptosis is implicated strongly in cancer and in autoimmune and degenerative diseases[1].

In Vivo

BCL2 Protein, Human (1 mg/mouse, ip, every 12 hours for 3 days) reduces the number of apoptotic cells in the heart and intestine, improves the survival rate of mice in cecal ligation and puncture (CLP)-induced sepsis models[2].
BCL2 Protein, Human (1 mg/mouse, ip, single dose) reduces cell apoptosis after ischemia-reperfusion (I/R) injury, attenuates the I/R injury of hindlimb skeletal muscle and myocardium in mouse ischemia-reperfusion model[3].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human BCL2 is present at 10 μg/mL, can bind Recombinant Mouse Bcl-XL. The ED50 for this effect is 0.07-0.15 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human BCL2 is present at 10 μg/mL, can bind Recombinant Mouse Bcl-XL. The ED50 for this effect is 0.1441 μg/mL.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

P10415-1 (M1-D211)

Gene ID

596  [NCBI]

Molecular Construction
N-term
BCL2 (M1-D211)
Accession # P10415
6*His
C-term
Protein Length

Partial

Synonyms
rHuApoptosis Regulator Bcl-2, His; B-cell Lymphoma 2; Apoptosis Regulator Bcl-2
AA Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

Molecular Weight

Approximately 22-27 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 100 mM arginine, pH 8.0, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

BCL2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BCL2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCL2 Protein, Human (His)
Cat. No.:
HY-P7537
Quantity:
MCE Japan Authorized Agent: