BCL2 Protein, Human (His)

BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.

Key regulators include proteins of the Bcl-2 family, some of which (e.g., Bcl-2, Bcl-xL, Mcl-1, and A1) promote cell survival while others (e.g., Bax and Bak) antagonize it. Disrupted regulation of apoptosis is implicated strongly in cancer and in autoimmune and degenerative diseases^[1].

BCL2 Protein, Human (1 mg/mouse, ip, every 12 hours for 3 days) reduces the number of apoptotic cells in the heart and intestine, improves the survival rate of mice in cecal ligation and puncture (CLP)-induced sepsis models^[2].
BCL2 Protein, Human (1 mg/mouse, ip, single dose) reduces cell apoptosis after ischemia-reperfusion (I/R) injury, attenuates the I/R injury of hindlimb skeletal muscle and myocardium in mouse ischemia-reperfusion model^[3].

Measured by its binding ability in a functional ELISA. When Recombinant Human BCL2 is present at 10 μg/mL, can bind Recombinant Mouse Bcl-XL. The ED₅₀ for this effect is 0.1426-0.1441 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human BCL2 is present at 10 μg/mL, can bind Recombinant Mouse Bcl-XL. The ED₅₀ for this effect is 0.1441 μg/mL.

Human

E. coli

C-6*His

P10415-1 (M1-D211)

596  [NCBI]

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

Approximately 22-27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filter solution of 50 mM Tris-HCl, 10% glycerin, pH 8.0 or 50 mM Tris-HCL, 150 mM NaCl, 100mM arginine, pH 8.0 , 20% Glycerol or PBS, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Print CG, et al. Apoptosis regulator bcl-w is essential for spermatogenesis but appears otherwise redundant. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12424-31.  [Content Brief]

  [2]. Iwata A, et al., Extracellular administration of BCL2 protein reduces apoptosis and improves survival in a murine model of sepsis. PLoS One. 2011 Feb 24;6(2):e14729.  [Content Brief]

  [3]. Iwata A, et al., Extracellular BCL2 proteins are danger-associated molecular patterns that reduce tissue damage in murine models of ischemia-reperfusion injury. PLoS One. 2010 Feb 8;5(2):e9103.  [Content Brief]