BCL2 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1). BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1). BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.
BCL2 is a protein that plays a crucial role in regulating cell death, specifically by controlling the permeability of the mitochondrial membrane. It is involved in a feedback loop system with caspases, which are enzymes responsible for initiating cell death. BCL2 inhibits caspase activity by either preventing the release of cytochrome c from the mitochondria or by binding to the apoptosis-activating factor (APAF-1).
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Front Vet Sci
Exploration of the protective mechanisms of Icariin against cisplatin-induced renal cell damage in canines. [Abstract]2024 Feb 21:11:1331409. PMID: 38455257
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P10417-1 (G5-P205)
-
Molecular Construction
-
N-term
-
6*His
-
BCL2 (G5-P205)
Accession # P10417-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BCL2; Protein Phosphatase 1, Regulatory Subunit 50; BCL2 Apoptosis Regulator; B-Cell CLL/Lymphoma 2; Apoptosis Regulator Bcl-2; BCL2, Apoptosis Regulator; PPP1R50; BCL2 Protein; Bcl-2
-
AA Sequence
GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
-
Predicted Molecular Mass
26.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
