BDNF Protein, Mouse (R129A, R130A, HEK293, C-His)

BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A, , , mutation. The total length of BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is 231 a.a., with molecular weight of ~35-42 kDa.

The BDNF protein serves as a pivotal signaling molecule, activating cascades downstream of NTRK2 and playing diverse roles in neuronal development and function. During development, BDNF promotes the survival and differentiation of specific neuronal populations in both the peripheral and central nervous systems, influencing axonal growth, pathfinding, and the modulation of dendritic growth and morphology. It emerges as a major regulator of synaptic transmission and plasticity in various regions of the CNS, contributing to adaptive neuronal responses such as long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, and the homeostatic regulation of intrinsic neuronal excitability. This versatility underscores its integral role in shaping neuronal connectivity and function. Additionally, BDNF activates signaling cascades through the heterodimeric receptor formed by NGFR and SORCS2, further influencing synaptic plasticity and long-term depression. Notably, its interaction with NGFR and SORCS2 is implicated in promoting neuronal apoptosis and growth cone collapse, highlighting its multifaceted impact on neuronal physiology and development.

Immobilized Recombinant Human BDNF at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human TrkB. The ED₅₀ for this effect is ≤91.22 ng/mL.

Mouse

HEK293

C-6*His

P21237-1 (A19-R249, R129A, R130A)

12064

APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Approximately 33-42 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.