Beta-lactamase CTX-M-1/Bla Protein, E.coli (His)

Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.

Beta-lactamase CTX-M-1/Bla Protein is a broad-spectrum beta-lactamase that plays a crucial role in antibiotic resistance by conferring resistance to penicillins, as well as first, second, and third-generation cephalosporins. Its enzymatic activity contributes to the hydrolysis of these beta-lactam antibiotics, allowing bacteria to evade the antimicrobial effects of these commonly used drugs. This resistance mechanism poses a significant challenge in the clinical treatment of bacterial infections, emphasizing the importance of understanding and addressing the molecular basis of antibiotic resistance.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

E.coli

E. coli

N-6*His

P28585 (Q29-L291)

/

Full Length of Mature Protein

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Approximately 32.2 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.