Beta-lactamase CTX-M-1/Bla Protein, E.coli (His)
Based on 1 Customer Validation
Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.
Background
Beta-lactamase CTX-M-1/Bla Protein is a broad-spectrum beta-lactamase that plays a crucial role in antibiotic resistance by conferring resistance to penicillins, as well as first, second, and third-generation cephalosporins. Its enzymatic activity contributes to the hydrolysis of these beta-lactam antibiotics, allowing bacteria to evade the antimicrobial effects of these commonly used drugs. This resistance mechanism poses a significant challenge in the clinical treatment of bacterial infections, emphasizing the importance of understanding and addressing the molecular basis of antibiotic resistance.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-6*His
-
Accession
P28585 (Q29-L291)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
Bla (Q29-L291)
Accession # P28585 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
men1; bla; Cefotaximase 1; Beta-lactamase MEN-1; EC:3.5.2.6; Beta-lactamase CTX-M-1
-
AA Sequence
QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
-
Predicted Molecular Mass
32.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
