BMP-13/GDF-6 Protein, Mouse
Based on 1 publication(s) in Google Scholar
The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free.
BMP-13/GDF-6 Protein, a versatile growth factor, orchestrates critical roles in cellular processes, including the regulation of proliferation and differentiation in both the retina and bone formation. Its pivotal involvement in retinal development includes the control of apoptosis and the establishment of dorsal-ventral positional information, crucial for the formation of the retinotectal map. Moreover, BMP-13/GDF-6 is indispensable for the normal development of bones and joints in various anatomical regions, such as limbs, skull, digits, and axial skeleton. Its significance extends to shaping species-specific changes in skeletal structures, suggesting a role in the evolution of distinct anatomical features. This multifaceted growth factor positively regulates chondrogenic tissue differentiation through specific receptor subunits, including BMPR1A, BMPR1B, BMPR2, and ACVR2A, activating the SMAD1-SMAD5-SMAD8 complex. Notably, the regulation of chondrogenic differentiation faces inhibition by NOG. Additionally, BMP-13/GDF-6 participates in the induction of adipogenesis from mesenchymal stem cells, employing growth factor receptor subunits BMPR1A, BMPR2, and ACVR2A, along with the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38. This intricate molecular ballet unfolds through homodimerization, forming disulfide-linked structures.
Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is typically 0.85-5 µg/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Tissue Eng
Therapeutic potential and mechanisms of umbilical cord mesenchymal stem cells differentiating into tendon cells and promotion of rotator cuff tendon-bone healing. [Abstract]2025 Jan 29:16:20417314251315185. PMID: 39882545
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P43028 (T335-R454)
-
Molecular Construction
-
N-term
-
BMP-13 (T335-R454)
Accession # P43028 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDF6; BMP-13; Prev. SGM1; GDF6 Protein; BMP13; CDMP2; Growth/Differentiation Factor 16; SYNS4; Growth/Differentiation Factor 6; GDF-6; Bone Morphogenetic Protein 13; GDF16; KFS1; KFSL; KFS; KFM; Growth Differentiation Factor 6; Segmentation Syndrome 1
-
AA Sequence
TAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
-
Predicted Molecular Mass
14.4 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCL, 500 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
