Copy Link Print Information

BMP-15 Protein, Human (His, Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BMP-15 Protein, Human (His, Myc)
  • BMP-15 Protein, Human (His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells.

Background

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth and differentiation factor 9B (GDF9B), is a polymorphic ligand protein belonging to the TGFβ family and expresses exclusively in the oocyte[1].
BMP15 is closely related to GDF9, which is essential for early ovarian folliculogenesis[1].
BMP15 and GDF9 involve in the genetic control of follicular development. Their main functions include regulating cellular proliferation/differentiation, follicular survival/atresia, and oocyte maturation, to creat an environment supporting follicle selection and growth[2].
BMP15 involves in p38 MAPK pathway to up-regulate anti-Mullerian hormone (AMH) expression in granulosa cells, which is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles[3].
Otherwise, BMP15 binds HIF-1α/SCF signaling pathway to induce stem cell factor (SCF) expression in human GCs of polycystic ovary syndrome (PCOS) related follicles[4].
BMP-15 is widely found in different animals, while the sequence in human is different from rat (63.66%), and mouse (64.01).

In Vitro

BMP-15 (huamn; 500 ng/mL; 48 h) induces FSHR expression in HGrC1 cells[5].
BMP-15 (huamn; 500 ng/mL; 0-90 min) increases phosphorylation of Smad 1/5/8 in HGrC1 cells[5].

Verified Bioactivity

Measured by its ability to induce Smad3 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 10 ng/mL can effectively induce Smad3 phosphorylation.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce Smad3 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 10 ng/mL can effectively induce Smad3 phosphorylation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession

    O95972 (Q268-R392)

  • Gene ID
    9210  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • BMP-15 (Q268-R392)
      Accession # O95972
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BMP15; GDF-9B; Bone Morphogenetic Protein 15; BMP-15; GDF9B; ODG2; Growth/Differentiation Factor 9B; POF4

  • AA Sequence

    QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

  • Predicted Molecular Mass

    21.4 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Galloway SM, et al. Bmp15 mutations and ovarian function. Mol Cell Endocrinol. 2002 May 31;191(1):15-8. [Content Brief]

[2]. Liu MN, et al. The role of BMP15 and GDF9 in the pathogenesis of primary ovarian insufficiency. Hum Fertil (Camb). 2021 Dec;24(5):325-332. [Content Brief]

[3]. Zhao Z, et al. BMP15 regulates AMH expression via the p38 MAPK pathway in granulosa cells from goat. Theriogenology. 2018 Sep 15;118:72-79. [Content Brief]

[4]. Cao LY, et al. Aberrant BMP15/HIF-1α/SCF signaling pathway in human granulosa cells is involved in the PCOS related abnormal follicular development. Gynecol Endocrinol. 2022 Sep 23:1-7. [Content Brief]

[5]. Shimizu K, et al. Molecular mechanism of FSHR expression induced by BMP15 in human granulosa cells. J Assist Reprod Genet. 2019 Jun;36(6):1185-1194. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce Smad3 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 10 ng/mL can effectively induce Smad3 phosphorylation.

  • BMP-15 Protein, Human (His, Myc) Product Image
    1/16
  • Experimental Validation Results for BMP-15 Protein, Human (His, Myc)
  • BMP-15 Protein, Human (His, Myc) Product Image