BMP-15 Protein, Human (His, Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells.

Background

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth and differentiation factor 9B (GDF9B), is a polymorphic ligand protein belonging to the TGFβ family and expresses exclusively in the oocyte[1].
BMP15 is closely related to GDF9, which is essential for early ovarian folliculogenesis[1].
BMP15 and GDF9 involve in the genetic control of follicular development. Their main functions include regulating cellular proliferation/differentiation, follicular survival/atresia, and oocyte maturation, to creat an environment supporting follicle selection and growth[2].
BMP15 involves in p38 MAPK pathway to up-regulate anti-Mullerian hormone (AMH) expression in granulosa cells, which is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles[3].
Otherwise, BMP15 binds HIF-1α/SCF signaling pathway to induce stem cell factor (SCF) expression in human GCs of polycystic ovary syndrome (PCOS) related follicles[4].
BMP-15 is widely found in different animals, while the sequence in human is different from rat (63.66%), and mouse (64.01).

In Vitro

BMP-15 (huamn; 500 ng/mL; 48 h) induces FSHR expression in HGrC1 cells[5].
BMP-15 (huamn; 500 ng/mL; 0-90 min) increases phosphorylation of Smad 1/5/8 in HGrC1 cells[5].

Verified Bioactivity

Measured by its ability to induce Smad3 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 10 ng/mL can effectively induce Smad3 phosphorylation.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce Smad3 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 10 ng/mL can effectively induce Smad3 phosphorylation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • BMP-15 (Q268-R392)
      Accession # O95972
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BMP15; GDF-9B; Bone Morphogenetic Protein 15; BMP-15; GDF9B; ODG2; Growth/Differentiation Factor 9B; POF4

  • AA Sequence

    QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

  • Predicted Molecular Mass

    21.4 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00