1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-15
  6. BMP-15 Protein, Human (His, Myc)

BMP-15 Protein, Human (His, Myc)

Cat. No.: HY-P72426
COA Handling Instructions

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. The total length of human BMP-15 protein is 392 amino acids (M1-R392), with 4 glycosylation domains. BMP-15 Protein, Human (His, Myc) has a total length of 125 amino acids (Q268-R392), is expressed in E. coli cells with a N-terminal His-tag, a C-terminal Myc-tag, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $75 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. The total length of human BMP-15 protein is 392 amino acids (M1-R392), with 4 glycosylation domains. BMP-15 Protein, Human (His, Myc) has a total length of 125 amino acids (Q268-R392), is expressed in E. coli cells with a N-terminal His-tag, a C-terminal Myc-tag, respectively.

Background

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth and differentiation factor 9B (GDF9B), is a polymorphic ligand protein belonging to the TGFβ family and expresses exclusively in the oocyte[1].
BMP15 is closely related to GDF9, which is essential for early ovarian folliculogenesis[1].
BMP15 and GDF9 involve in the genetic control of follicular development. Their main functions include regulating cellular proliferation/differentiation, follicular survival/atresia, and oocyte maturation, to creat an environment supporting follicle selection and growth[2].
BMP15 involves in p38 MAPK pathway to up-regulate anti-Mullerian hormone (AMH) expression in granulosa cells, which is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles[3].
Otherwise, BMP15 binds HIF-1α/SCF signaling pathway to induce stem cell factor (SCF) expression in human GCs of polycystic ovary syndrome (PCOS) related follicles[4].
BMP-15 is widely found in different animals, while the sequence in human is different from rat (63.66%), and mouse (64.01).

In Vitro

BMP-15 (huamn; 500 ng/mL; 48 h) induces FSHR expression in HGrC1 cells[5].
BMP-15 (huamn; 500 ng/mL; 0-90 min) increases phosphorylation of Smad 1/5/8 in HGrC1 cells[5].

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

O95972 (Q268-R392)

Gene ID
Molecular Construction
N-term
10*His
BMP-15 (Q268-R392)
Accession # O95972
C-term
Synonyms
Growth/differentiation factor 9B
AA Sequence

QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Molecular Weight

Approximately 23.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BMP-15 Protein, Human (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-15 Protein, Human (His, Myc)
Cat. No.:
HY-P72426
Quantity:
MCE Japan Authorized Agent: