1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. BTN3A1/CD277
  5. BTN3A1/CD277 Protein, Human (225a.a, HEK293, His)

BTN3A1/CD277 Protein, Human (225a.a, HEK293, His)

Cat. No.: HY-P72763
Handling Instructions

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (225a.a, HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BTN3A1/CD277 Protein, Human (225a.a, HEK293, His) is 225 a.a., with molecular weight of 28-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (225a.a, HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of BTN3A1/CD277 Protein, Human (225a.a, HEK293, His) is 225 a.a., with molecular weight of 28-35 kDa.

Background

The BTN3A1/CD277 protein is involved in crucial functions related to T-cell activation and the adaptive immune response. It acts as a regulator of activated T-cell proliferation and controls the release of cytokines and IFNG by these cells. Additionally, it plays a role in mediating the response of T-cells towards infected and transformed cells that exhibit elevated levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. The BTN3A1/CD277 protein functions as a homodimer.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00481 (Q30-G254)

Gene ID
Molecular Construction
N-term
BTN3A1 (Q30-G254)
Accession # O00481
6*His
C-term
Synonyms
Butyrophilin subfamily 3 member A1; CD277; BTN3A1; BTF5
AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Weight

28-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTN3A1/CD277 Protein, Human (225a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTN3A1/CD277 Protein, Human (225a.a, HEK293, His)
Cat. No.:
HY-P72763
Quantity:
MCE Japan Authorized Agent: