BTNL8 Protein, Human (HEK293, hFc)

BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293, with C-hFc labeled tag. The total length of BTNL8 Protein, Human (HEK293, hFc) is 221 a.a., with molecular weight of approximately 65 kDa.

BTNL8 protein potentially functions as a stimulator of the primary immune response, exerting its effects on T-cells that are sub-optimally stimulated through the TCR/CD3 complex. Its activity involves promoting the proliferation of T-cells and enhancing the production of cytokines.

Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED₅₀ for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.

• 
  Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED₅₀ for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.

Human

HEK293

C-hFc

Q6UX41-1 (Q18-K238)

79908  [NCBI]

QWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATK

approximately 65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.