1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. Butyrophilin Like 8 (BTNL8)
  5. BTNL8 Protein, Human (HEK293, hFc)

BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

BTNL8 protein potentially functions as a stimulator of the primary immune response, exerting its effects on T-cells that are sub-optimally stimulated through the TCR/CD3 complex. Its activity involves promoting the proliferation of T-cells and enhancing the production of cytokines.

Biological Activity

Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED50 for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.

  • Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED50 for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6UX41-1 (Q18-K238)

Gene ID
Molecular Construction
N-term
BTNL8 (Q18-K238)
Accession # Q6UX41-1
hFc
C-term
Synonyms
Butyrophilin-like protein 8; BTNL8; Butyrophilin-like 8
AA Sequence

QWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATK

Molecular Weight

approximately 65 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BTNL8 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTNL8 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P79382
Quantity:
MCE Japan Authorized Agent: