BTNL8 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
BTNL8 protein potentially functions as a stimulator of the primary immune response, exerting its effects on T-cells that are sub-optimally stimulated through the TCR/CD3 complex. Its activity involves promoting the proliferation of T-cells and enhancing the production of cytokines.
Verified Bioactivity
Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED50 for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q6UX41-1 (Q18-K238)
-
Molecular Construction
-
N-term
-
BTNL8 (Q18-K238)
Accession # Q6UX41-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BTNL8; FLJ21458; Butyrophilin Like 8; B7-H5 Costimulatory Molecule; BTN9.2; Butyrophilin-Like 8; Butyrophilin-Like Protein 8
-
AA Sequence
QWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATK
-
Molecular Weight
Approximately 53-63 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
