Carbonic Anhydrase 14 Protein, Human (HEK293, His)

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 14 Protein, Human (HEK293, His) is 275 a.a., with molecular weight of 45-48 kDa.

Carbonic Anhydrase 14 Protein is an enzyme that catalyzes the reversible hydration of carbon dioxide. Its main function is to facilitate the conversion of carbon dioxide to bicarbonate ions and protons, and vice versa. This enzymatic activity is crucial in various physiological processes, including acid-base balance regulation, respiration, and maintenance of cellular pH homeostasis. Carbonic Anhydrase 14 Protein plays a pivotal role in carbon dioxide transport and metabolism within the body.

Human

HEK293

C-His

Q9ULX7/NP_036245.1 (A16-M290)

23632  [NCBI]

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

45-48 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.