Copy Link Print Information

Cathepsin D Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Cathepsin D Protein, Human (HEK293, His)
  • Cathepsin D Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Cathepsin D protein is an acidic protease that actively participates in intracellular protein breakdown. Studies have shown that it is critical in the processing of amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation. Cathepsin D Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cathepsin D, an acid protease, exerts its activity in the intracellular breakdown of proteins. This protease is implicated in the processing of amyloid precursor protein (APP), with its cleavage and activation by ADAM30 leading to the degradation of APP, as evidenced in studies. Cathepsin D's involvement extends to the pathogenesis of various diseases, including breast cancer, and it is suggested to play a role in Alzheimer's disease, highlighting its significance in cellular processes and potential connections to pathological conditions.

Verified Bioactivity

Measured by its ability to cleave a peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 4624.96 pmol/min/µg, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P07339 (L21-L412)

  • Gene ID
    1509  [NCBI]
  • Molecular Construction
    • N-term
    • Cathepsin D (L21-L412)
      Accession # P07339
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    CTSD; Cathepsin D (Lysosomal Aspartyl Protease); Prev. CPSD; Lysosomal Aspartyl Protease; CLN10; Cathepsin D Isoform 2; Ceroid-Lipofuscinosis, Neuronal 10; HEL-S-130P; Epididymis Secretory Sperm Binding Protein Li 130P; Cathepsin D; Lysosomal Aspartyl Pep

  • AA Sequence

    LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Cathepsin D Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Cathepsin D Protein, Human (HEK293, His)
  • Cathepsin D Protein, Human (HEK293, His) Product Image