Cathepsin D Protein, Human (HEK293, C-His)

Cathepsin D Protein, an acid protease, actively participates in intracellular protein breakdown. It is crucial in processing amyloid precursor protein (APP), with ADAM30-mediated cleavage and activation leading to APP degradation, as demonstrated in studies. Cathepsin D's relevance spans diseases like breast cancer and implicates a role in Alzheimer's disease, underscoring its importance in cellular processes and potential links to pathological conditions. Cathepsin D Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin D protein, expressed by HEK293, with C-6*His labeled tag. The total length of Cathepsin D Protein, Human (HEK293, C-His) is 392 a.a., with molecular weight of ~44.78 kDa.

Cathepsin D, an acid protease, exerts its activity in the intracellular breakdown of proteins. This protease is implicated in the processing of amyloid precursor protein (APP), with its cleavage and activation by ADAM30 leading to the degradation of APP, as evidenced in studies. Cathepsin D's involvement extends to the pathogenesis of various diseases, including breast cancer, and it is suggested to play a role in Alzheimer's disease, highlighting its significance in cellular processes and potential connections to pathological conditions.

Measured by its ability to cleave a peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 4624.96 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-6*His

P07339 (L21-L412)

1509  [NCBI]

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Approximately 44.78 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.