CCR5 Protein, Human (Cell-Free, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CCR5 Protein, a receptor for inflammatory CC-chemokines like CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, transduces signals, elevating intracellular calcium levels. It regulates granulocytic lineage and facilitates T-lymphocyte migration to infection sites. In microbial infection, CCR5 acts as a coreceptor, along with CD4, for HIV-1, emphasizing its role in the cellular response to infections. CCR5 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR5 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of CCR5 Protein, Human (Cell-Free, His) is 352 a.a., with molecular weight of 43.9 kDa.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CCR5 Protein, a receptor for inflammatory CC-chemokines like CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, transduces signals, elevating intracellular calcium levels. It regulates granulocytic lineage and facilitates T-lymphocyte migration to infection sites. In microbial infection, CCR5 acts as a coreceptor, along with CD4, for HIV-1, emphasizing its role in the cellular response to infections. CCR5 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR5 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of CCR5 Protein, Human (Cell-Free, His) is 352 a.a., with molecular weight of 43.9 kDa.

Background

CCR5 functions as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, leading to the transduction of signals that elevate intracellular calcium ion levels. This receptor is implicated in the regulation of granulocytic lineage proliferation or differentiation and plays a crucial role in facilitating T-lymphocyte migration to infection sites by acting as a chemotactic receptor. In the context of microbial infection, CCR5 acts as a coreceptor, with CD4 being the primary receptor, for human immunodeficiency virus-1/HIV-1, underscoring its significance in the cellular response to infections.

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • CCR5 (M1-L352)
      Accession # P51681
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CCR5; Chemokine (C-C Motif) Receptor 5 (Gene/Pseudogene); Prev. CMKBR5; C-C Motif Chemokine Receptor 5 A159A; CC-CKR-5; Chemokine Recptor CCR5 Delta32; C-C Chemokine Receptor Type 5; Mutant Chemokine Receptor CCR5; IDDM22; Mutant Chemokine Receptor 5; CKR-5; CC Chemokine Receptor 5; CD195; Chemokine Receptor 5; CKR5; CD195 Antigen; Mutant C-C Motif Chemokine Receptor; C-C CKR-5; Chemokine (C-C Motif) Receptor 5; Chemr13; HIV-1 Fusion Coreceptor; CHEMR13; Chemokine Receptor CCR5; CCCKR5; CCR-5; C-C Motif Chemokine Receptor 5; C-C Motif Chemokine Receptor 5 (Gene/Pseudogene)

  • AA Sequence

    MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

  • Predicted Molecular Mass

    43.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00