CCR5 Protein, Human (Cell-Free, His)
Based on 1 publication(s) in Google Scholar
CCR5 Protein, a receptor for inflammatory CC-chemokines like CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, transduces signals, elevating intracellular calcium levels. It regulates granulocytic lineage and facilitates T-lymphocyte migration to infection sites. In microbial infection, CCR5 acts as a coreceptor, along with CD4, for HIV-1, emphasizing its role in the cellular response to infections. CCR5 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR5 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of CCR5 Protein, Human (Cell-Free, His) is 352 a.a., with molecular weight of 43.9 kDa.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCR5 Protein, a receptor for inflammatory CC-chemokines like CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, transduces signals, elevating intracellular calcium levels. It regulates granulocytic lineage and facilitates T-lymphocyte migration to infection sites. In microbial infection, CCR5 acts as a coreceptor, along with CD4, for HIV-1, emphasizing its role in the cellular response to infections. CCR5 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR5 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of CCR5 Protein, Human (Cell-Free, His) is 352 a.a., with molecular weight of 43.9 kDa.
Background
CCR5 functions as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, leading to the transduction of signals that elevate intracellular calcium ion levels. This receptor is implicated in the regulation of granulocytic lineage proliferation or differentiation and plays a crucial role in facilitating T-lymphocyte migration to infection sites by acting as a chemotactic receptor. In the context of microbial infection, CCR5 acts as a coreceptor, with CD4 being the primary receptor, for human immunodeficiency virus-1/HIV-1, underscoring its significance in the cellular response to infections.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Reprod Immunol
ROS-CCL5 axis recruits CD8+ T lymphocytes promoting the apoptosis of granulosa cells in diminished ovary reserve. [Abstract]2023 Feb:155:103789. PMID: 36603466
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P51681 (M1-L352)
-
Gene ID1234
-
Molecular Construction
-
N-term
-
10*His
-
CCR5 (M1-L352)
Accession # P51681 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CCR5; Chemokine (C-C Motif) Receptor 5 (Gene/Pseudogene); Prev. CMKBR5; C-C Motif Chemokine Receptor 5 A159A; CC-CKR-5; Chemokine Recptor CCR5 Delta32; C-C Chemokine Receptor Type 5; Mutant Chemokine Receptor CCR5; IDDM22; Mutant Chemokine Receptor 5; CKR-5; CC Chemokine Receptor 5; CD195; Chemokine Receptor 5; CKR5; CD195 Antigen; Mutant C-C Motif Chemokine Receptor; C-C CKR-5; Chemokine (C-C Motif) Receptor 5; Chemr13; HIV-1 Fusion Coreceptor; CHEMR13; Chemokine Receptor CCR5; CCCKR5; CCR-5; C-C Motif Chemokine Receptor 5; C-C Motif Chemokine Receptor 5 (Gene/Pseudogene)
-
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
-
Predicted Molecular Mass
43.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)