CD133/PROM1 Protein, Rat (HEK293, Fc)

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag. The total length of CD133/PROM1 Protein, Rat (HEK293, Fc) is 254 a.a., with molecular weight of ~70-95 KDa.

CD133/PROM1 Protein is predicted to possess actinin binding activity, cadherin binding activity, and cholesterol binding activity. The protein is anticipated to be involved in various processes, including glomerular epithelial cell differentiation, photoreceptor cell maintenance, and retina morphogenesis in camera-type eyes. Predicted to be located in cellular components such as the endoplasmic reticulum-Golgi intermediate compartment, extracellular exosome, and photoreceptor outer segment membrane, CD133 is expected to be active in cellular components like the apical plasma membrane, microvillus, and prominosome. Additionally, it is predicted to be an integral component of the plasma membrane. CD133 is used in the study of diabetes mellitus and is implicated in human conditions such as cone-rod dystrophy 12 and retinitis pigmentosa 41. Notably, CD133 exhibits biased expression in tissues, with prominent levels observed in the lung, kidney, and eight other tissues, suggesting its diverse functional roles in these organs.

Data is not available.

Rat

HEK293

N-mFc

NP_001103607.1 (N171-Y424)

60357  [NCBI]

NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLQSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY

Approximately 70-95 kDa.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.