2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  5. CD300a
  6. CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc)

CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc)

Cat. No.: HY-P72514
Handling Instructions

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc) is 156 a.a., with molecular weight of 58-75 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc) is 156 a.a., with molecular weight of 58-75 kDa.
Background

CD300a/LMIR1 protein serves as an inhibitory receptor that potentially contributes to the down-regulation of cytolytic activity in natural killer (NK) cells and the attenuation of mast cell degranulation. Additionally, it plays a negative regulatory role in Toll-like receptor (TLR) signaling, specifically mediated by MYD88 but not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 interacts with PTN6/SHP-1 and PTPN11/SHP-2, along with INPP5D.
Species

Mouse
Source

HEK293
Tag

C-hFc
Accession

Q6SJQ0 (L28-R183)
Gene ID

217303  [NCBI]
Molecular Construction
N-term
CD300A (L28-R183)
Accession # Q6SJQ0
hFc
C-term
Synonyms
CMRF35-like molecule 8; CLM-8; MAIR-1; CD300a
AA Sequence

LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR

Molecular Weight

58-75 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300a/LMIR1 Protein, Mouse (156a.a, HEK293, Fc)
Cat. No.:
HY-P72514
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.