CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)
CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Background
The CD367/CLEC4A protein potentially plays a role in regulating immune reactivity and may have implications in modulating the differentiation and maturation of dendritic cells (DC). It is a C-type lectin receptor that can bind to carbohydrates such as mannose and fucose, as well as weakly interact with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. CD367/CLEC4A is involved in inhibiting B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Upon antigen stimulation, it undergoes clathrin-dependent endocytosis, delivering its antigenic cargo into the antigen presentation pathway and promoting cross-priming of CD8(+) T cells. This cross-presentation and cross-priming process can be enhanced by TLR7 and TLR8 agonists, resulting in increased expansion of CD8(+) T cells and high production of IFNG and TNF, while reducing levels of IL4, IL5, and IL13. In plasmacytoid dendritic cells, CD367/CLEC4A inhibits TLR9-mediated production of IFNA and TNF. Furthermore, its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) may contribute to the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;C-Myc;N-SUMO
-
Accession
Q9QZ15 (Q70-L238)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
CLEC4A (Q70-L238)
Accession # Q9QZ15 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4A; C-Type Lectin Superfamily Member 6; Prev. CLECSF6; Lectin-Like Immunoreceptor; DCIR; C-Type Lectin DDB27; DDB27; LLIR; CD367; C-Type Lectin Domain Family 4, Member A; HDCIR; CD367 Antigen; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain
-
AA Sequence
QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
-
Predicted Molecular Mass
39.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
