2. Recombinant Proteins
  3. CD Antigens
  4. B Cell CD Proteins
  5. CD37/Tspan-26
  6. CD37 Protein, Bovine (Cell-Free, His)

CD37 Protein, Bovine (Cell-Free, His)

Cat. No.: HY-P702239
Handling Instructions

CD37 protein interacts with the signaling adaptor SCIMP. CD37 Protein, Bovine (Cell-Free, His) is the recombinant bovine-derived CD37 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CD37 Protein, Bovine (Cell-Free, His) is 280 a.a., with molecular weight of 37.8 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD37 protein interacts with the signaling adaptor SCIMP. CD37 Protein, Bovine (Cell-Free, His) is the recombinant bovine-derived CD37 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CD37 Protein, Bovine (Cell-Free, His) is 280 a.a., with molecular weight of 37.8 kDa.
Background

CD37 Protein, expressed on B cells, is involved in various immune processes. It acts as a regulator of B cell receptor signaling and controls B cell activation and survival. Understanding the functions of CD37 Protein can aid in studying B cell-related disorders and developing targeted therapies for immune-mediated diseases.
Species

Bovine
Source

E. coli Cell-free
Tag

N-10*His
Accession

Q2KHY8 (M1-R280)
Gene ID

508751
Molecular Construction
N-term
10*His
CD37 (M1-R280)
Accession # Q2KHY8
C-term
Synonyms
Leukocyte antigen CD37; CD37
AA Sequence

MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKVLAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVKDVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCSCYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNNLISIVGICLGVGLLELSFMTLSIFLCRNLDHVYDRLARYR

Molecular Weight

37.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CD37 Protein, Bovine (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD37 Protein, Bovine (Cell-Free, His)
Cat. No.:
HY-P702239
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.