CD38 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, His) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, His) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The CD38 protein performs multiple essential functions. It is responsible for synthesizing two crucial second messengers, cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate. Cyclic ADP-ribose acts as a second messenger for glucose-induced insulin secretion, while nicotinate-adenine dinucleotide phosphate functions as a calcium mobilizer. CD38 also possesses cADPR hydrolase activity, adding to its functional repertoire. Additionally, CD38 regulates osteoclastic bone resorption, most likely through the production of cyclic ADP-ribose and the initiation of a calcium ion signal via activation of the ryanodine receptor.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q64244 (W45-V303)
-
Molecular Construction
-
N-term
-
CD38 (W45-V303)
Accession # Q64244 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD38; NAD(+) Nucleosidase; CD38 Molecule; CD38 Antigen (P45); ADP-Ribosyl Cyclase 1; ADPRC 1; ADP-Ribosyl Cyclase/Cyclic ADP-Ribose Hydrolase 1; Ecto-Nicotinamide Adenine Dinucleotide Glycohydrolase; 2'-Phospho-Cyclic-ADP-Ribose Transferase; Cluster Of Di
-
AA Sequence
WPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV
-
Predicted Molecular Mass
30.8 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
