CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc)

The CD3E protein, with predicted functions like SH3 domain binding and protein heterodimerization, plays a crucial role in nervous system development and cell adhesion. It is involved in T cell activation, cytokine production, and signal transduction. Located in various cellular components, its expression is observed in the colon and hemolymphoid system. CD3E, the human ortholog, has implications in immunodeficiency 18, emphasizing its role in immune system functionality. Biased expression occurs in the thymus and spleen, highlighting its importance in immune processes. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc) is a recombinant protein dimer complex containing mouse-derived CD3E-CD3G Heterodimer protein, expressed by HEK293, with C-hFc labeled tag. CD3E-CD3G Heterodimer Protein, Mouse (HEK293, Fc), has molecular weight of ~38-40 kDa.

The CD3E protein, predicted to possess various functions such as SH3 domain binding activity, identical protein binding activity, and protein heterodimerization activity, plays a crucial role in nervous system development and the positive regulation of cell adhesion. It is actively involved upstream of multiple processes, including positive regulation of T cell activation, positive regulation of cytokine production, and regulation of signal transduction. The protein is located in diverse cellular components, including dendritic spines, the external side of the plasma membrane, and immunological synapses. As part of the alpha-beta T cell receptor complex, its expression is observed in the colon and hemolymphoid system. The human ortholog of this gene, CD3E, has implications in immunodeficiency 18, highlighting its significance in immune system functionality. Biased expression is evident in tissues such as the thymus and spleen, underscoring its role in immune processes.

Immobilized Human CD3E-CD3G at 2 μg/mL (100 μL/well) can bind Anti-CD3 Antibody. The ED₅₀ for this effect is 1.792 ng/mL.

• 
  Immobilized Human CD3E-CD3G at 2 μg/mL (100 μL/well) can bind Anti-CD3 Antibody, The ED₅₀ for this effect is 1.792ng/mL.

Mouse

HEK293

C-hFc

NP_031674.1 (D23-D108)&NP_033980.1 (Q23-S116)

12501  [NCBI]&12502  [NCBI]

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
&:
QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTIS

Approximately 38-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.