CD47 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD47 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
Background
Targeting CD47 is in the spotlight of cancer immunotherapy. Blocking CD47 triggers the recognition and elimination of cancer cells by the innate immunity. The CD47/SIRP-α axis has been established as an important regulator of innate anti-cancer immunity, with many if not all malignancies overexpressing the receptor CD47 that binds to phagocyte-expressed SIRP-α[1].
Verified Bioactivity
2 µg/mL (100 µL/well) of immoblized recombinant human SIRPa-His can bind human CD47-Fc with a linear range of 0.25-185 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q08722-1 (Q19-P139)
-
Molecular Construction
-
N-term
-
CD47 (Q19-P139)
Accession # Q08722-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3
-
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
-
Predicted Molecular Mass
40.9 kDa
-
Molecular Weight
Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
