CD7 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CD7 Protein is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. CD7 plays a vital role in T and NK cell functions after binding to its ligands (K12 protein and galectin-1). CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development. CD7 is also invovled in T and NK cell activation and/or adhesion. CD7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD7 Protein is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. CD7 plays a vital role in T and NK cell functions after binding to its ligands (K12 protein and galectin-1). CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development. CD7 is also invovled in T and NK cell activation and/or adhesion[1][2][4]. CD7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD7, also known as GP40. CD7 is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. Besides, CD7 is also highly expressed in patients with various T cell derived malignancies, such as T-acute lymphoblastic leukemia (T-ALL), T cell lymphoblastic lymphoma (T-LBL), and acute myeloid leukemia (AML)[1].
CD7 has two ligands, K12 protein and galectin-1. CD7 plays a vital role in T and NK cell functions after binding to its ligands[1]. In addition, CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development[2]. It has been also reported that CD7 is involved in both HIV 1 infection and syncytia formation. In mice, CD7 is a key molecule in the lipopolysaccharide-induced inflammatory response[3]. Human CD7 shares about 50% aa sequence identity with mouse.
In conclusion, CD7 is mainly expressed on T and NK cells, and is invovled in T and NK cell activation and/or adhesion[4].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
A0A2K5VA16 (A26-P180)
-
Molecular Construction
-
N-term
-
CD7 (A26-P180)
Accession # A0A2K5VA16 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD7; LEU-9; CD7 Molecule; Tp40; T-Cell Antigen CD7; T-Cell Surface Antigen Leu-9; GP40; CD7 Antigen (P41); TP41; P41 Protein; T-Cell Leukemia Antigen; CD7 Antigen
-
AA Sequence
AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALP
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
