CD7 Protein, Cynomolgus (HEK293, His)

CD7 Protein is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. CD7 plays a vital role in T and NK cell functions after binding to its ligands (K12 protein and galectin-1). CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development. CD7 is also invovled in T and NK cell activation and/or adhesion^[1][2][4]. CD7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

CD7, also known as GP40. CD7 is a 40-kDa membrane protein that belongs to the immunoglobulin superfamily. CD7 is mainly expressed in T cells and natural killer (NK) cells. Besides, CD7 is also highly expressed in patients with various T cell derived malignancies, such as T-acute lymphoblastic leukemia (T-ALL), T cell lymphoblastic lymphoma (T-LBL), and acute myeloid leukemia (AML)^[1].
CD7 has two ligands, K12 protein and galectin-1. CD7 plays a vital role in T and NK cell functions after binding to its ligands^[1]. In addition, CD7 plays an important role in T-cell and T-cell/B-cell interactions during early lymphoid development^[2]. It has been also reported that CD7 is involved in both HIV 1 infection and syncytia formation. In mice, CD7 is a key molecule in the lipopolysaccharide-induced inflammatory response^[3]. Human CD7 shares about 50% aa sequence identity with mouse.
In conclusion, CD7 is mainly expressed on T and NK cells, and is invovled in T and NK cell activation and/or adhesion^[4].

Cynomolgus

HEK293

C-6*His

A0A2K5VA16 (A26-P180)

102124399  [NCBI]

Partial

AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALP

Approximately 32-34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.