1. Recombinant Proteins
  2. Others
  3. CEBP delta/CEBPD Protein, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

The CEBP delta/CEBPD protein serves as a transcription activator, recognizing two distinct DNA motifs: the CCAAT homology found in many promoters and the enhanced core homology prevalent in enhancers. This transcription factor plays a crucial role in regulating the expression of genes associated with immune and inflammatory responses. Functioning both as a homodimer and a heterodimer, CEBP delta enhances IL6 transcription independently and as a heterodimer with CEBPB. Additionally, it can form stable heterodimers not only with CEBPB but also with CEBPA and CEBPE. Notably, CEBP delta directly interacts with SPI1/PU.1, and this interaction does not impact the DNA-binding properties of each partner. Furthermore, CEBP delta engages in an interaction with PRDM16, further highlighting its versatile role in transcriptional regulation.

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P49716 (S2-R269)

Gene ID
Molecular Construction
N-term
10*His
CEBPD (S2-R269)
Accession # P49716
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C/EBP delta; C/EBP related protein 3; CCAAT/enhancer binding protein C/EBP; delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBP D; CEBPD; CEBPD_HUMAN; CELF; Crp 3; Crp3; NF IL6 beta; NF-IL6-beta; Nuclear factor NF IL6 beta; Nuclear factor NF-IL6-beta
AA Sequence

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Predicted Molecular Mass
35.8 kDa
Molecular Weight

Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEBP delta/CEBPD Protein, Human (His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CEBP delta/CEBPD Protein, Human (His-Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEBP delta/CEBPD Protein, Human (His-Myc)
Cat. No.:
HY-P72134
Quantity:
MCE Japan Authorized Agent: