CLPS Protein, Rat (HEK293, His)

CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.

CLPS, or Colipase, is a protein that enables enzyme activator activity and is involved in positive regulation of catalytic activity, post-embryonic development, and response to food. It is predicted to be located in the extracellular region. The human ortholog(s) of this gene have been implicated in type 2 diabetes mellitus, highlighting its potential role in metabolic regulation. The expression of CLPS is restricted, suggesting specific involvement in certain tissues or physiological contexts, with a notable expression level of RPKM 1512.3.

Measured by its binding ability in a functional ELISA. Immobilized Rat CLPS at 10μg/mL (100μL/well) can bind Biotinylated Human PNLIP. The ED₅₀ for this effect is 1.817μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat CLPS at 10 μg/mL (100μL/well) can bind Biotinylated Human PNLIP. The ED₅₀ for this effect is 1.817 μg/mL.

Rat

HEK293

C-6*His

NP_037271 (A18-Q112)

25680  [NCBI]

Full Length of Mature Protein

APGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGVCLDSTRSKQ

Approximately 12 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hek293-cell.html  [Content Brief]