CLPS Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.
Background
CLPS, or Colipase, is a protein that enables enzyme activator activity and is involved in positive regulation of catalytic activity, post-embryonic development, and response to food. It is predicted to be located in the extracellular region. The human ortholog(s) of this gene have been implicated in type 2 diabetes mellitus, highlighting its potential role in metabolic regulation. The expression of CLPS is restricted, suggesting specific involvement in certain tissues or physiological contexts, with a notable expression level of RPKM 1512.3.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Rat CLPS at 10μg/mL (100μL/well) can bind Biotinylated Human PNLIP. The ED50 for this effect is 1.817μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
NP_037271 (A18-Q112)
-
Molecular Construction
-
N-term
-
CLPS (A18-Q112)
Accession # NP_037271 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CLPS; Pancreatic Colipase Preproprotein Isoform 1; Colipase; Pancreatic Colipase Preproprotein; Colipase, Pancreatic; Pancreatic Colipase
-
AA Sequence
APGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGVCLDSTRSKQ
-
Molecular Weight
Approximately 12 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
