CLPS Protein, Human (sf9, His)

CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.

Colipase (CLPS) is a vital cofactor for pancreatic lipase, facilitating its anchoring to the lipid-water interface. This interaction is crucial for the enzyme's stability and effectiveness in lipid digestion. In the absence of colipase, pancreatic lipase is prone to being washed away by bile salts, which exert an inhibitory effect on the lipase. Colipase's role in enhancing lipase activity underscores its significance in efficient lipid hydrolysis within the digestive system. Furthermore, the biological activity of enterostatin as a satiety signal suggests a potential role for colipase in the regulation of appetite and food intake, further highlighting its multifaceted functions in digestive processes and metabolic regulation (

Measured by its binding ability in a functional ELISA. Immobilized CLPS at 10 μg/mL(100 μL/well) can bind biotinylated PNLIP. The ED₅₀ for this effect is 1.183 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized CLPS at 10 μg/mL(100 μL/well) can bind biotinylated PNLIP (HY-P75978). The ED₅₀ for this effect is 1.183 μg/mL.

Human

Sf9 insect cells

C-His

P04118 (A18-Q112)

1208  [NCBI]

Full Length of Mature Protein

APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

Approximately 12 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 637 mM NaCl, 2.7 mM KCl, 10 mM Na₂HPO₄, 1.8 mM KH₂PO₄, 10% glycerol, pH 7.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.