CLPS Protein, Human (sf9, His)
Based on 1 Customer Validation
CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Colipase (CLPS) is a vital cofactor for pancreatic lipase, facilitating its anchoring to the lipid-water interface. This interaction is crucial for the enzyme's stability and effectiveness in lipid digestion. In the absence of colipase, pancreatic lipase is prone to being washed away by bile salts, which exert an inhibitory effect on the lipase. Colipase's role in enhancing lipase activity underscores its significance in efficient lipid hydrolysis within the digestive system. Furthermore, the biological activity of enterostatin as a satiety signal suggests a potential role for colipase in the regulation of appetite and food intake, further highlighting its multifaceted functions in digestive processes and metabolic regulation (
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized CLPS at 10 μg/mL(100 μL/well) can bind biotinylated PNLIP. The ED50 for this effect is 1.183 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P04118 (A18-Q112)
-
Molecular Construction
-
N-term
-
CLPS (A18-Q112)
Accession # P04118 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CLPS; Pancreatic Colipase Preproprotein Isoform 1; Colipase; Pancreatic Colipase Preproprotein; Colipase, Pancreatic; Pancreatic Colipase
-
AA Sequence
APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
-
Predicted Molecular Mass
11.5 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 637 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 10% glycerol, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
