Clusterin/APOJ Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Clusterin/APOJ Protein functions as an extracellular chaperone, preventing the aggregation of non-native proteins and inhibiting stress-induced aggregation of blood plasma proteins. It plays a crucial role in inhibiting the formation of amyloid fibrils by various proteins, including APP, APOC2, B2M, CALCA, CSN3, and aggregation-prone LYZ variants in vitro. This chaperone, which does not require ATP, maintains partially unfolded proteins in a state suitable for subsequent refolding by other chaperones like HSPA8/HSC70, although it does not refold proteins independently. Upon binding to cell surface receptors, it triggers internalization of the chaperone-client complex, leading to lysosomal or proteasomal degradation. When secreted, it protects cells against apoptosis and complement-induced cytolysis. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, promoting the ubiquitination and proteasomal degradation of target proteins. Clusterin/APOJ also modulates NF-kappa-B transcriptional activity and, following stress, promotes apoptosis. It inhibits apoptosis by interfering with BAX-dependent release of cytochrome c into the cytoplasm when associated with the mitochondrial membrane. Additionally, it plays a role in the regulation of cell proliferation and, when secreted, acts as a modulator during neuronal differentiation through interaction with STMN3. The protein is found in an antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain, self-associates to form higher oligomers, and interacts with a broad range of misfolded proteins, including APP, APOC2, and LYZ. Interactions with various proteins, such as APOA1, LRP2, CLUAP1, PON1, XRCC6, SYVN1, COMMD1, BTRC, CUL1, BAX, HSPA5, BCL2L1, TGFBR2, ACVR1, STMN3, VLDLR, and LRP8, contribute to its diverse functions and regulatory roles.

Verified Bioactivity

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Clusterin (E22-E448)
      Accession # Q06890
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CLU; Complement-Associated Protein SP-40,40; Prev. APOJ; Complement Lysis Inhibitor; Prev. CLI; Ku70-Binding Protein 1; Apolipoprotein J; NA1/NA2; TRPM-2; Clusterin (Complement Lysis Inhibitor, SP-40,40, Sulfated Glycoprotein 2, Testosterone-Repressed Pro

  • AA Sequence

    EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE

  • Molecular Weight

    Approximately 28-50 kDa & 70 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00