Clusterin/APOJ Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Clusterin/APOJ proteins act as extracellular chaperones, inhibiting stress-induced plasma protein aggregation and preventing the formation of amyloid fibrils by various proteins. It maintains partially unfolded proteins in a proper state for refolding by other partners. Clusterin/APOJ Protein, Mouse (HEK293, His) is the recombinant mouse-derived Clusterin/APOJ protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The Clusterin/APOJ Protein functions as an extracellular chaperone, preventing the aggregation of non-native proteins and inhibiting stress-induced aggregation of blood plasma proteins. It plays a crucial role in inhibiting the formation of amyloid fibrils by various proteins, including APP, APOC2, B2M, CALCA, CSN3, and aggregation-prone LYZ variants in vitro. This chaperone, which does not require ATP, maintains partially unfolded proteins in a state suitable for subsequent refolding by other chaperones like HSPA8/HSC70, although it does not refold proteins independently. Upon binding to cell surface receptors, it triggers internalization of the chaperone-client complex, leading to lysosomal or proteasomal degradation. When secreted, it protects cells against apoptosis and complement-induced cytolysis. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, promoting the ubiquitination and proteasomal degradation of target proteins. Clusterin/APOJ also modulates NF-kappa-B transcriptional activity and, following stress, promotes apoptosis. It inhibits apoptosis by interfering with BAX-dependent release of cytochrome c into the cytoplasm when associated with the mitochondrial membrane. Additionally, it plays a role in the regulation of cell proliferation and, when secreted, acts as a modulator during neuronal differentiation through interaction with STMN3. The protein is found in an antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain, self-associates to form higher oligomers, and interacts with a broad range of misfolded proteins, including APP, APOC2, and LYZ. Interactions with various proteins, such as APOA1, LRP2, CLUAP1, PON1, XRCC6, SYVN1, COMMD1, BTRC, CUL1, BAX, HSPA5, BCL2L1, TGFBR2, ACVR1, STMN3, VLDLR, and LRP8, contribute to its diverse functions and regulatory roles.
Verified Bioactivity
Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q06890 (E22-E448)
-
Molecular Construction
-
N-term
-
Clusterin (E22-E448)
Accession # Q06890 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CLU; Complement-Associated Protein SP-40,40; Prev. APOJ; Complement Lysis Inhibitor; Prev. CLI; Ku70-Binding Protein 1; Apolipoprotein J; NA1/NA2; TRPM-2; Clusterin (Complement Lysis Inhibitor, SP-40,40, Sulfated Glycoprotein 2, Testosterone-Repressed Pro
-
AA Sequence
EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE
-
Molecular Weight
Approximately 28-50 kDa & 70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)