Collectin-11/CL-K1 Protein, Human (HEK293, His)

Collectin-11/CL-K1 is an important lectin in innate immunity, apoptosis, and embryogenesis that recognizes sugars presenting high mannose oligosaccharides with at least one terminal α-1,2-linked mannose epitope protein. It also recognizes fucosylated glycans and lipopolysaccharides. Collectin-11/CL-K1 Protein, Human (HEK293, His) is the recombinant human-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collectin-11/CL-K1 Protein, Human (HEK293, His) is 246 a.a., with molecular weight of 30-35 kDa.

The Collectin-11/CL-K1 protein serves as a lectin crucial in innate immunity, apoptosis, and embryogenesis. This calcium-dependent lectin recognizes self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope, primarily focusing on the terminal disaccharide of the glycan. Additionally, it identifies a subset of fucosylated glycans and lipopolysaccharides. In innate immunity, Collectin-11/CL-K1 binds non-self sugars on microorganisms, activating the complement through the recruitment of MAPS1. In apoptosis, the protein binds DNA on the surface of apoptotic cells in a calcium-independent manner, triggering complement activation in response to this binding. Furthermore, Collectin-11/CL-K1 contributes to development, potentially serving as a guidance cue during the migration of neural crest cells and other cell types in embryogenesis. The protein forms homotrimers through disulfide linkages and interacts with MASP1, likely initiating the lectin pathway of complement activation.

Human

HEK293

C-6*His

Q9BWP8 (Q26-M271)

78989  [NCBI]

QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

30-35 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.