Collectrin Protein, Mouse (Myc, His-SUMO)

The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag. The total length of Collectrin Protein, Mouse (Myc, His-SUMO) is 127 a.a., with molecular weight of ~34.5 kDa.

The Collectrin protein assumes a crucial role in amino acid transport by serving as a binding partner for amino acid transporters SLC6A18 and SLC6A19, thereby regulating their trafficking on the cell surface and modulating their activity. It may also play a part in the trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Furthermore, Collectrin acts as a regulator of SNARE complex function and functions as a stimulator of beta cell replication. It exists both as a monomer and a homodimer, with the dimerization preventing CLTRN cleavage by BACE2. In its functional role, Collectrin interacts with SNAPIN and amino acid transporters SLC6A18, SLC6A19, and SLC6A20B, intricately regulating their membrane trafficking and amino acid transporter activities. These molecular interactions highlight Collectrin's versatile involvement in amino acid transport and cellular processes, emphasizing its significance in maintaining proper cellular function.

Mouse

E. coli

N-His;C-Myc;N-SUMO

Q9ESG4 (15E-141P)

57394  [NCBI]

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Approximately 34.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.