Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO)
The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
Background
The Collectrin protein assumes a crucial role in amino acid transport by serving as a binding partner for amino acid transporters SLC6A18 and SLC6A19, thereby regulating their trafficking on the cell surface and modulating their activity. It may also play a part in the trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Furthermore, Collectrin acts as a regulator of SNARE complex function and functions as a stimulator of beta cell replication. It exists both as a monomer and a homodimer, with the dimerization preventing CLTRN cleavage by BACE2. In its functional role, Collectrin interacts with SNAPIN and amino acid transporters SLC6A18, SLC6A19, and SLC6A20B, intricately regulating their membrane trafficking and amino acid transporter activities. These molecular interactions highlight Collectrin's versatile involvement in amino acid transport and cellular processes, emphasizing its significance in maintaining proper cellular function.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;C-Myc;N-SUMO
-
Accession
Q9ESG4 (E15-P141)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
Collectrin (E15-P141)
Accession # Q9ESG4 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLTRN; Collectrin; Prev. TMEM27; Kidney-Specific Membrane Protein; Transmembrane Protein 27; NX-17; Collectrin, Amino Acid Transport Regulator; NX17
-
AA Sequence
ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
-
Predicted Molecular Mass
34.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
