Collectrin/TMEM27 Protein, Human (HEK293, Fc)

Collectrin, also known as TMEM27, plays a key role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface trafficking and amino acid transporter activity. Suggested to facilitate the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Human (HEK293, Fc) is the recombinant human-derived Collectrin/TMEM27 protein, expressed by HEK293 , with C-hFc labeled tag.

The Collectrin protein, also known as TMEM27, plays a pivotal role in amino acid transport by serving as a binding partner for amino acid transporters SLC6A18 and SLC6A19, thereby regulating their trafficking on the cell surface and influencing their amino acid transporter activity. It is proposed to contribute to the trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Additionally, Collectrin acts as a regulator of SNARE complex function and functions as a stimulator of beta cell replication. Structurally, Collectrin exists both as a monomer and a homodimer, with the dimerization preventing CLTRN cleavage by BACE2. In terms of molecular interactions, Collectrin interacts with SLC6A18 and SLC6A19, intricately regulating their membrane trafficking and amino acid transporter activities, while also forming an interaction with SNAPIN. These findings underscore Collectrin's multifaceted involvement in amino acid transport and cellular processes, highlighting its crucial role in maintaining proper cellular function.

Human

HEK293

C-hFc

Q9HBJ8 (E15-P141)

57393  [NCBI]

Extracellular Domain

ELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVP

53-57 kDa

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.