COPZ1 Protein, Human/Mouse/Rat (His)
Based on 1 Customer Validation
The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.
- Species: Rat; Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.
Background
The COPZ1 protein is a crucial component of the coatomer, a cytosolic protein complex with a pivotal role in intracellular protein transport. This complex binds to dilysine motifs and forms reversible associations with Golgi non-clathrin-coated vesicles, facilitating the transport of biosynthetic proteins from the endoplasmic reticulum (ER) through the Golgi to the trans-Golgi network. The coatomer complex is indispensable for the budding of vesicles from Golgi membranes and plays a vital role in the retrograde transport of dilysine-tagged proteins from the Golgi to the ER. The zeta subunit of the coatomer is implicated in regulating coat assembly, thereby influencing the rate of biosynthetic protein transport due to its association-dissociation properties within the coatomer complex. This oligomeric complex comprises at least the alpha, beta, beta', gamma, delta, epsilon, and zeta subunits.
Technical Parameters
-
Species Rat; Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P61923/NP_001101587.1 (M1-R177)
-
Molecular Construction
-
N-term
-
His
-
COPZ1 (M1-R177)
Accession # P61923 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
COPZ1; Coatomer Protein Complex, Subunit Zeta 1; Prev. COPZ; Alternative Protein COPZ1; COPI Coat Complex Subunit Zeta 1; Coatomer Subunit Zeta; CGI-120; Zeta1-COP; Coatomer Protein Complex, Subunit Zeta; Zeta-COP; Coatomer Subunit Zeta-1; HSPC181; Zeta-1
-
AA Sequence
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
-
Molecular Weight
Approximately 22.4 kDa.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
