COPZ1 Protein, Rat (His)

The COPZ1 protein is a key coating subunit essential for intracellular protein transport. In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles. COPZ1 Protein, Rat (His) is the recombinant rat-derived COPZ1 protein, expressed by E. coli , with N-His labeled tag. The total length of COPZ1 Protein, Rat (His) is 177 a.a., with molecular weight of ~22.4 KDa.

The COPZ1 protein is a crucial component of the coatomer, a cytosolic protein complex with a pivotal role in intracellular protein transport. This complex binds to dilysine motifs and forms reversible associations with Golgi non-clathrin-coated vesicles, facilitating the transport of biosynthetic proteins from the endoplasmic reticulum (ER) through the Golgi to the trans-Golgi network. The coatomer complex is indispensable for the budding of vesicles from Golgi membranes and plays a vital role in the retrograde transport of dilysine-tagged proteins from the Golgi to the ER. The zeta subunit of the coatomer is implicated in regulating coat assembly, thereby influencing the rate of biosynthetic protein transport due to its association-dissociation properties within the coatomer complex. This oligomeric complex comprises at least the alpha, beta, beta', gamma, delta, epsilon, and zeta subunits.

Rat

E. coli

N-His

P61923 (M1-R177)

22818  [NCBI]

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Approximately 22.4 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 50 mM Arg, pH 8.5. or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.