1. Recombinant Proteins
  2. Others
  3. COPZ1 Protein, Human/Mouse/Rat (His)

COPZ1 Protein, Human/Mouse/Rat (His)

Cat. No.: HY-P76847
SDS COA Handling Instructions

The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.

Background

The COPZ1 protein is a crucial component of the coatomer, a cytosolic protein complex with a pivotal role in intracellular protein transport. This complex binds to dilysine motifs and forms reversible associations with Golgi non-clathrin-coated vesicles, facilitating the transport of biosynthetic proteins from the endoplasmic reticulum (ER) through the Golgi to the trans-Golgi network. The coatomer complex is indispensable for the budding of vesicles from Golgi membranes and plays a vital role in the retrograde transport of dilysine-tagged proteins from the Golgi to the ER. The zeta subunit of the coatomer is implicated in regulating coat assembly, thereby influencing the rate of biosynthetic protein transport due to its association-dissociation properties within the coatomer complex. This oligomeric complex comprises at least the alpha, beta, beta', gamma, delta, epsilon, and zeta subunits.

Species

Rat; Mouse

Source

E. coli

Tag

N-His

Accession

P61923/NP_001101587.1 (M1-R177)

Gene ID
Molecular Construction
N-term
His
COPZ1 (M1-R177)
Accession # P61923
C-term
Synonyms
Coatomer subunit zeta-1; Zeta-1-coat protein; Zeta-1 COP; COPZ; CGI-120
AA Sequence

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Molecular Weight

Approximately 22.4 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 50 mM Arg, pH 8.5. or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

COPZ1 Protein, Human/Mouse/Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COPZ1 Protein, Human/Mouse/Rat (His)
Cat. No.:
HY-P76847
Quantity:
MCE Japan Authorized Agent: