Cystatin C/CST3 Protein, Human (HEK293, C-His)

Cystatin C/CST3 protein crucially inhibits cysteine proteinases, locally regulating their enzyme activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. In hemolysis, Cystatin C/CST3 plays a vital role in clearing complexes formed with Haptoglobin. Acting as an antioxidant, exhibiting antibacterial activity, and contributing to the acute phase response modulation, the homodimeric structure enhances its effectiveness as an enzyme inhibitor. Cystatin C/CST3 Protein, Human (HEK293, C-His) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293, with C-10*His labeled tag. The total length of Cystatin C/CST3 Protein, Human (HEK293, C-His) is 120 a.a., with molecular weight of 15-17 kDa.

The Cystatin C/CST3 protein serves a crucial physiological role as an inhibitor of cysteine proteinases, acting as a local regulator of their enzyme activity. It is known to capture and bind free plasma hemoglobin, preventing kidney damage and enabling the hepatic recycling of heme iron. In cases of hemolysis, where hemoglobin can accumulate in the kidneys and be secreted in urine, Cystatin C/CST3 plays a vital role in clearing the complexes formed between hemoglobin and Haptoglobin. Additionally, Cystatin C/CST3 acts as an antioxidant, exhibits antibacterial activity, and contributes to modulating various aspects of the acute phase response. The protein's homodimeric structure further enhances its functionality and effectiveness as an enzyme inhibitor.

Human

HEK293

C-10*His

P01034 (S27-A146)

1471  [NCBI]

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

15-17 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.