Cystatin C/CST3 Protein, Human (HEK293, His)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin C/CST3 Protein, Human (HEK293, His) is 120 a.a., with molecular weight of 15-18 kDa.

The Cystatin C/CST3 protein serves a crucial physiological role as an inhibitor of cysteine proteinases, acting as a local regulator of their enzyme activity. It is known to capture and bind free plasma hemoglobin, preventing kidney damage and enabling the hepatic recycling of heme iron. In cases of hemolysis, where hemoglobin can accumulate in the kidneys and be secreted in urine, Cystatin C/CST3 plays a vital role in clearing the complexes formed between hemoglobin and Haptoglobin. Additionally, Cystatin C/CST3 acts as an antioxidant, exhibits antibacterial activity, and contributes to modulating various aspects of the acute phase response. The protein's homodimeric structure further enhances its functionality and effectiveness as an enzyme inhibitor.

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC₅₀ value is 91.68 nM.

Human

HEK293

C-His

P01034 (S27-A146)

1471  [NCBI]

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

15-18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 0.01% Tween 80, 1 mM EDTA, 50% Glycerol, pH 8.0 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.