1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin-1
  5. Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His)

Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His)

Cat. No.: HY-P7867A
Handling Instructions

Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His) is 121 a.a., with molecular weight of ~16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7867

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His) is 121 a.a., with molecular weight of ~16 kDa.

Background

Cystatin SN (CST1), a component of human saliva, belongs to the cysteine proteinase inhibitor family, sharing immunological similarity with cystatin S. Despite this similarity, Cystatin SN exhibits distinct specificity due to amino acid sequence variations. With a pI of 7.5, Cystatin SN stands out as a potent inhibitor of papain and dipeptidyl peptidase I, outperforming cystatin S in these inhibitory activities. Notably, both Cystatin SN and cystatin S demonstrate equal proficiency in inhibiting ficin. This highlights the intricate variations in the inhibitory capabilities within the cystatin family present in saliva, emphasizing their potential roles in regulating specific proteolytic activities.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P01037 (W21-S141)

Gene ID
Molecular Construction
N-term
CST1 (W21-S141)
Accession # P01037
10*His
C-term
Synonyms
rHuCystatin-SN/CST1, His; Cystatin-SN; Cystain-SA-I; Cystatin-1; Salivary Cystatin-SA-1; CST1
AA Sequence

WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin SN/CST1 Protein, Human (121a.a, HEK293, C-His)
Cat. No.:
HY-P7867A
Quantity:
MCE Japan Authorized Agent: