Cystatin SN/CST1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Cystatin SN (CST1), a component of human saliva, belongs to the cysteine proteinase inhibitor family, sharing immunological similarity with cystatin S. Despite this similarity, Cystatin SN exhibits distinct specificity due to amino acid sequence variations. With a pI of 7.5, Cystatin SN stands out as a potent inhibitor of papain and dipeptidyl peptidase I, outperforming cystatin S in these inhibitory activities. Notably, both Cystatin SN and cystatin S demonstrate equal proficiency in inhibiting ficin. This highlights the intricate variations in the inhibitory capabilities within the cystatin family present in saliva, emphasizing their potential roles in regulating specific proteolytic activities.
Verified Bioactivity
Measured in a cytotoxicity assay using A549 human non-small-cell lung carcinoma cells. The ED50 this effect is 0.4193 ng/mL, corresponding to a specific activity is 2.3849×106 units/mg. (Activation description: The proenzyme needs to be activated in acid reducing buffer for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P01037 (W21-S141)
-
Molecular Construction
-
N-term
-
CST1 (W21-S141)
Accession # P01037 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CST1; Cysteine Proteinase Inhibitor, Type 2 Family; Cystatin SN; Cystatin SA-I; Salivary Cystatin-SA-1; Cystatin 1; Cystain-SA-I; Cystatin-1; Cystatin-SN
-
AA Sequence
WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
