DCBLD2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.
DCBLD2 encodes discoid, CUB, and LCCL domain protein 2, also known as endothelial and smooth muscle cell-derived neuropilin-like protein (ESDN) and/or Charcot-Leyden crystalloprotein pseudogene 1 (CLCP1). The DCBLD2 gene is a type I transmembrane receptor that has structural similarities to neuropilin-like transmembrane scaffold receptors, such as vascular endothelial growth factor (VEGF) receptors and signaling proteins, and has multiple functions in developmental processes as well as in vascular and tumor biology. DCBLD2 is a novel platelet membrane receptor that plays a key role in vascular remodeling, influencing vascular smooth muscle cell (VSMC) proliferation, cell movement and metastasis in some cancers, and neuronal localization. DCBLD2 recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis[1][2][3][4][5].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96PD2-1 (Q67-A528)
-
Molecular Construction
-
N-term
-
DCBLD2 (Q67-A528)
Accession # Q96PD2-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
DCBLD2; Endothelial And Smooth Muscle Cell-Derived Neuropilin-Like Protein; Discoidin, CUB And LCCL Domain Containing 2; Discoidin, CUB And LCCL Domain-Containing Protein 2; CLCP1; Coagulation Factor V/VIII-Homology Domains Protein 1; ESDN; DCBLD2 Protein
-
AA Sequence
QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVA
-
Predicted Molecular Mass
52.2 kDa
-
Molecular Weight
Approximately 80-110 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
