DCBLD2 Protein, Human (HEK293, His)

DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DCBLD2 Protein, Human (HEK293, His) is 462 a.a., with molecular weight of 80-110 kDa.

DCBLD2 encodes discoid, CUB, and LCCL domain protein 2, also known as endothelial and smooth muscle cell-derived neuropilin-like protein (ESDN) and/or Charcot-Leyden crystalloprotein pseudogene 1 (CLCP1). The DCBLD2 gene is a type I transmembrane receptor that has structural similarities to neuropilin-like transmembrane scaffold receptors, such as vascular endothelial growth factor (VEGF) receptors and signaling proteins, and has multiple functions in developmental processes as well as in vascular and tumor biology. DCBLD2 is a novel platelet membrane receptor that plays a key role in vascular remodeling, influencing vascular smooth muscle cell (VSMC) proliferation, cell movement and metastasis in some cancers, and neuronal localization. DCBLD2 recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis^{[1][2][3][4][5]}.

Human

HEK293

C-6*His

Q96PD2 (Q67-A528)

131566  [NCBI]

QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVA

80-110 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.