1. Recombinant Proteins
  2. Others
  3. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)

DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)

Cat. No.: HY-P76870
Handling Instructions Technical Support

The DEFA3/defensin alpha 3 protein is a potent effector in innate immunity against a variety of infectious agents, including bacteria, fungi, and viruses. It neutralizes bacterial toxins, such as Bacillus anthracis lethal factor and Staphylococcus aureus leukocidin, and plays a key role in blocking herpes simplex virus infection by preventing viral attachment. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFA3/Defensin alpha 3 protein, expressed by HEK293 , with N-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The DEFA3/defensin alpha 3 protein is a potent effector in innate immunity against a variety of infectious agents, including bacteria, fungi, and viruses. It neutralizes bacterial toxins, such as Bacillus anthracis lethal factor and Staphylococcus aureus leukocidin, and plays a key role in blocking herpes simplex virus infection by preventing viral attachment. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFA3/Defensin alpha 3 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The DEFA3/Defensin alpha 3 Protein functions as a potent effector molecule within the innate immune system, leveraging antibiotic-like properties to combat a broad spectrum of infectious agents, including bacteria, fungi, and viruses. Notably, it exhibits the capability to neutralize bacterial toxins such as B. anthracis lethal factor, Clostridium difficile cytotoxin B, and Staphylococcus aureus leukocidin. Additionally, DEFA3 plays a pivotal role in blocking herpes simplex virus infection by interacting with envelope glycoprotein B, preventing its attachment to heparan sulfate, a key receptor for viral attachment. This multifaceted immune activity underscores the protein's significance in host defense. DEFA3 operates as a dimer, showcasing its structural organization in executing its diverse antimicrobial functions.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P59666 (D39-C94)

Gene ID
Molecular Construction
N-term
hFc
DEFA3 (D39-C94)
Accession # P59666
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Neutrophil defensin 3; HNP-3; Neutrophil defensin 2; HNP-2; DEF3
AA Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

분자량

Approximately 36 kDa.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76870
수량:
MCE Japan Authorized Agent: