1. Recombinant Proteins
  2. Others
  3. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)

DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)

Cat. No.: HY-P76870
COA Handling Instructions

The DEFA3/defensin alpha 3 protein is a potent effector in innate immunity against a variety of infectious agents, including bacteria, fungi, and viruses. It neutralizes bacterial toxins, such as Bacillus anthracis lethal factor and Staphylococcus aureus leukocidin, and plays a key role in blocking herpes simplex virus infection by preventing viral attachment. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFA3/Defensin alpha 3 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is 56 a.a., with molecular weight of ~36 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $55 In-stock
10 μg $85 In-stock
50 μg $215 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DEFA3/defensin alpha 3 protein is a potent effector in innate immunity against a variety of infectious agents, including bacteria, fungi, and viruses. It neutralizes bacterial toxins, such as Bacillus anthracis lethal factor and Staphylococcus aureus leukocidin, and plays a key role in blocking herpes simplex virus infection by preventing viral attachment. DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFA3/Defensin alpha 3 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) is 56 a.a., with molecular weight of ~36 KDa.

Background

The DEFA3/Defensin alpha 3 Protein functions as a potent effector molecule within the innate immune system, leveraging antibiotic-like properties to combat a broad spectrum of infectious agents, including bacteria, fungi, and viruses. Notably, it exhibits the capability to neutralize bacterial toxins such as B. anthracis lethal factor, Clostridium difficile cytotoxin B, and Staphylococcus aureus leukocidin. Additionally, DEFA3 plays a pivotal role in blocking herpes simplex virus infection by interacting with envelope glycoprotein B, preventing its attachment to heparan sulfate, a key receptor for viral attachment. This multifaceted immune activity underscores the protein's significance in host defense. DEFA3 operates as a dimer, showcasing its structural organization in executing its diverse antimicrobial functions.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P59666 (D39-C94)

Gene ID
Molecular Construction
N-term
hFc
DEFA3 (D39-C94)
Accession # P59666
C-term
Synonyms
Neutrophil defensin 3; HNP-3; Neutrophil defensin 2; HNP-2; DEF3
AA Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Molecular Weight

Approximately 36 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DEFA3/Defensin alpha 3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76870
Quantity:
MCE Japan Authorized Agent: